"IGF1" Related Products

Expand
Expand

Recombinant Human IGF1

Cat.No.: IGF1-524H
Product Overview: Recombinant Human IGF1 produced in E. coli is approximately 7.4 kDa, a single non-glycosylated polypeptide chain containing 67 amino acids.
Description: The somatomedins, or insulin-like growth factors (IGFs), comprise a family of peptides that play important roles in mammalian growth and development. IGF1 mediates many of the growth-promoting effects of growth hormone (GH). Early studies showed that growth hormone did not directly stimulate the incorporation of sulfate into cartilage, but rather acted through a serum factor,termed "sulfation factor, which later became known as "somatomedin". Three main somatomedins have been characterized: somatomedin C (IGF1), somatomedin A (IGF2), and somatomedin B.
Source: E. coli
Species: Human
Form: Lyophilized from a 0.2 μm filtered concentrated solution in 20mM PB, pH 7.4, with 0.02% TWEEN 20.
Bio-activity: Fully biologically active when compared to standard. The ED50 determined by a cell proliferation assay using serum free human MCF-7 cells is less than 2 ng/ml, corresponding to a specific activity of >5×10^5 IU/mg.
Molecular Mass: 7.4 kDa
AA Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Endotoxin: Less than 50EU/mg of rHuDES1-3/IGF1 as determined by LAL method.
Purity: >97% by SDS-PAGE and HPLC analyses.
Usage: This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.
Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 centigrade to -70 centigrade. Avoid repeated freeze/thaw cycles.
Reconstitution: We recommend that this vial be briefy centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name: IGF1 insulin-like growth factor 1 (somatomedin C) [ Homo sapiens ]
Official Symbol: IGF1
Synonyms: IGF1; insulin-like growth factor 1 (somatomedin C); insulin-like growth factor 1; IGF1A; MGF; IGF-IA; IGF-IB; somatomedin-C; mechano growth factor; insulin-like growth factor I; insulin-like growth factor IA; insulin-like growth factor IB; IGFI; IGF-I;
Gene ID: 3479
mRNA Refseq: NM_000618
Protein Refseq: NP_000609
MIM: 147440
UniProt ID: P05019
Chromosome Location: 12q23.2
Pathway: Adipogenesis, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Apoptosis, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Dilated cardiomyopathy, organism-specific biosystem;
Function: growth factor activity; hormone activity; hormone activity; insulin receptor binding; insulin-like growth factor receptor binding; integrin binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.