| Species : |
Pig |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
134 |
| Description : |
IL-2 is a powerful immunoregulatory lymphokine produced by T-cells in response to antigenic or mitogenic stimulation. It is expressed by CD4+ and CD8+ T cells, γδ T cells, B cells, dendritic cells, and eosinophils. IL-2/IL-2R signaling is required for T-cell proliferation and other fundamental functions which are essential for the immune response. The receptor for IL-2 consists of three subunits (55 kDa IL2Rα, 75 kDa IL2Rβ, 64 kDa common gamma chain γc/IL2Rγ) that are present on the cell surface in varying preformed complexes. Recombinant porcine IL-2 is a 15.3 kDa protein containing 134 amino acid residues and it shares about 72 % amino acid sequence identity with mouse, human and rat IL-2. It also shares 60 % and 67 % acid sequence identity with rhesus macaque and equus caballus IL-2, respectively. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in 1 × PBS, pH 7.4. |
| Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine CTLL-2 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg. |
| Molecular Mass : |
Approximately 15.2 kDa, a single non-glycosylated polypeptide chain containing 134 amino acids. |
| AA Sequence : |
APTSSSTKNTKKQLEPLLLDLQLLLKEVKNYENADLSRMLTFKFYMPKQATELKHLQCLVEELKALEGVLNLGQSKNSDSANIKESMNNINVTVLELKGSETSFKCEYDDETVTAVEFLNKWITFCQSIYSTLT |
| Endotoxin : |
Less than 1 EU/μg of rPoIL-2 as determined by LAL method. |
| Purity : |
>96% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |