"HIF1A" Related Products

Expand
Expand
Expand

Recombinant Human HIF1A, His-tagged

Cat.No.: HIF1A-107H
Product Overview: Human HIF1A full-length ORF ( NP_851397.1, 1 a.a. - 735 a.a.) recombinant protein with His-tag at N-terminal.
Description: Hypoxia-inducible factor-1 (HIF-1), identified as one of the transcription factors, has been found to play an essential role in oxygen homeostasis. HIF-1 is a heterodimer composed of HIF-1β subunit and one of three subunits(Hif-1α, Hif-2( or Hif-3)). The activation of Hif-1( is closely associated with a variety of tumors and oncogenic pathways. Hif-1( consists of DNA binding domain(DBD domain), Dimerization domain and C-terminla regulatiory domains, including two transactivation domains(TAD), an oxygen-dependent degradation(ODD) domain, and inhibitory domains.
Source: E. coli
Species: Human
Tag: His
Form: Liquid
Molecular Mass: 100 kDa including tags
Protein length: 1 to 735aa
AA Sequence: MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIA PILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLL LFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHH HHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTENLYFQG MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYEL AHQLPLPHNVSSHLDKASVMRLTISYLRVRKLLDAGDLDI EDDMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYM GLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGLVKKGKE QNTQRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHV YDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSK TFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYH ALDSDHLTKTHHDMFTKGQVTTGQYRMLAKRGGYVWVETQ ATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECV LKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLL APAAGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLPSPN EKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEP NPESLELSFTMPQIQDQTPSPSDGSTRQSSPEPNSPSEYC FYVDSDMVNEFKLELVEKLFAEDTEAKNPFSTQDTDLDLE MLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVT VFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIA SPSPTHIHKETTSATSSPYRDTQSRTASPNRAGKGVIEQT EKSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKR KMEHDGSLFQAVGIG
Purity: > 75 % by SDS-PAGE. Purified by Ni chromatography and sterile filtered.
Storage: Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
Concentration: 100 µg at 0.3 mg/ml
Storage Buffer: Constituents: 0.61% Tris, 10% Glycerol, 0.88% Sodium chloride. pH: 8.00
Gene Name: HIF1A hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) [ Homo sapiens ]
Official Symbol: HIF1A
Synonyms: HIF1A; hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor); hypoxia-inducible factor 1-alpha; bHLHe78; HIF 1alpha; HIF1; MOP1; PASD8; HIF-1-alpha; member of PAS protein 1; ARNT interacting protein; ARNT-interacting protein; member of PAS superfamily 1; PAS domain-containing protein 8; basic-helix-loop-helix-PAS protein MOP1; class E basic helix-loop-helix protein 78; hypoxia-inducible factor 1 alpha isoform I.3; hypoxia-inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor); HIF-1alpha; HIF1-ALPHA;
Gene ID: 3091
mRNA Refseq: NM_001243084
Protein Refseq: NP_001230013
MIM: 603348
UniProt ID: Q16665
Chromosome Location: 14q23.2
Pathway: Adipogenesis, organism-specific biosystem; Angiogenesis, organism-specific biosystem; Circadian Clock, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem; Hypoxic and oxygen homeostasis regulation of HIF-1-alpha, organism-specific biosystem; NOTCH1 Intracellular Domain Regulates Transcription, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem;
Function: Hsp90 protein binding; histone acetyltransferase binding; histone deacetylase binding; protein binding; protein heterodimerization activity; protein heterodimerization activity; protein kinase binding; contributes_to sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; contributes_to sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; signal transducer activity; transcription factor binding; transcription regulatory region DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.