Recombinant Human HIF1A Protein, His&ABP tagged
Cat.No. : | HIF1A-003H |
Product Overview : | Recombinant Human hypoxia inducible factor 1 subunit alpha Protein with His&ABP tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | ABP&His |
Protein Length : | 682-823 aa |
Description : | This gene encodes the alpha subunit of transcription factor hypoxia-inducible factor-1 (HIF-1), which is a heterodimer composed of an alpha and a beta subunit. HIF-1 functions as a master regulator of cellular and systemic homeostatic response to hypoxia by activating transcription of many genes, including those involved in energy metabolism, angiogenesis, apoptosis, and other genes whose protein products increase oxygen delivery or facilitate metabolic adaptation to hypoxia. HIF-1 thus plays an essential role in embryonic vascularization, tumor angiogenesis and pathophysiology of ischemic disease. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. |
Tag : | His&ABP |
Form : | Liquid |
AA Sequence : | KSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALD |
Purity : | >80% by SDS-PAGE and Coomassie blue staining. |
Applications : | This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100× molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature. |
Storage : | At -20 centigrade, Avoid Freeze/Thaw Cycles |
Storage Buffer : | 1M urea/PBS, pH 7.4 |
Concentration : | ≥5.0 mg/mL |
Shipping : | Wet ice |
Gene Name | HIF1A hypoxia inducible factor 1 subunit alpha [ Homo sapiens (human) ] |
Official Symbol | HIF1A |
Synonyms | HIF1A; hypoxia inducible factor 1 subunit alpha; HIF1; MOP1; PASD8; HIF-1A; bHLHe78; HIF-1alpha; HIF1-ALPHA; HIF-1-alpha; hypoxia-inducible factor 1-alpha; ARNT interacting protein; PAS domain-containing protein 8; basic-helix-loop-helix-PAS protein MOP1; class E basic helix-loop-helix protein 78; hypoxia inducible factor 1 alpha subunit; hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor); hypoxia-inducible factor1alpha; member of PAS protein 1; member of PAS superfamily 1 |
Gene ID | 3091 |
mRNA Refseq | NM_001530 |
Protein Refseq | NP_001521 |
MIM | 603348 |
UniProt ID | Q16665 |
◆ Recombinant Proteins | ||
Hif1a-7717M | Recombinant Mouse Hif1a protein, His-tagged | +Inquiry |
HIF1A-2773H | Recombinant Human HIF1A, 576-785 aa, His-tagged | +Inquiry |
HIF1A-279H | Recombinant Human HIF1A protein, His/MBP-tagged | +Inquiry |
HIF1A-232HF | Recombinant Full Length Human HIF1A Protein, GST-tagged | +Inquiry |
HIF1A-136H | Recombinant Human HIF1A | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIF1A-787HCL | Recombinant Human HIF1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HIF1A Products
Required fields are marked with *
My Review for All HIF1A Products
Required fields are marked with *
0
Inquiry Basket