"RNASE3" Related Products

Expand

Recombinant Human RNASE3, His-tagged

Cat.No. : RNASE3-5319H
Product Overview : Recombinant Human Ribonuclease 3/RNASE3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Arg28-Ile160) of Human RNASE3 fused with a 6His tag at the C-terminus.
Description : Ribonuclease 3 (RNASE3) is a basic protein that is localized to the eosinophil primary matrix and belongs to the pancreatic ribonuclease family. RNASE3 is released during degranulation of eosinophils. RNASE3 possesses a wide variety of biological activities. RNASE3 interacts with bacterial lipopolysaccharide (LPS) and lipoteichoic acid (LTA). RNASE3 exhibits antibacterial activity, including cytoplasmic membrane depolarization of preferentially Gram-negative, but also Gram-positive strains. It promotes E. coli outer membrane detachment, alteration of the overall cell shape and partial loss of cell content.
Source : HEK293
Species : Human
Tag : His
AA Sequence : RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSR FRVPLLHCDLINPGAQNISNCRYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTIVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Shipping : The product is shipped on dry ice/ice packs.
Gene Name : RNASE3 ribonuclease, RNase A family, 3 [ Homo sapiens (human) ]
Official Symbol : RNASE3
Synonyms : RNASE3; ECP; RNS3; ribonuclease, RNase A family, 3; eosinophil cationic protein; RNase 3; ribonuclease 3; cytotoxic ribonuclease; EC 3.1.27.-
Gene ID : 6037
mRNA Refseq : NM_002935
Protein Refseq : NP_002926
MIM : 131398
UniProt ID : P12724
Chromosome Location : 14q24-q31
Pathway : Asthma
Function : nucleic acid binding; pancreatic ribonuclease activity; ribonuclease activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.