Cat.No. :	RNASE3-5319H
Product Overview :	Recombinant Human Ribonuclease 3/RNASE3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Arg28-Ile160) of Human RNASE3 fused with a 6His tag at the C-terminus.
Description :	Ribonuclease 3 (RNASE3) is a basic protein that is localized to the eosinophil primary matrix and belongs to the pancreatic ribonuclease family. RNASE3 is released during degranulation of eosinophils. RNASE3 possesses a wide variety of biological activities. RNASE3 interacts with bacterial lipopolysaccharide (LPS) and lipoteichoic acid (LTA). RNASE3 exhibits antibacterial activity, including cytoplasmic membrane depolarization of preferentially Gram-negative, but also Gram-positive strains. It promotes E. coli outer membrane detachment, alteration of the overall cell shape and partial loss of cell content.
Source :	HEK293
Species :	Human
Tag :	His
AA Sequence :	RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSR FRVPLLHCDLINPGAQNISNCRYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTIVDHHHHHH
Endotoxin :	Less than 0.1 ng/μg (1 IEU/μg).
Purity :	Greater than 95% as determined by reducing SDS-PAGE.
Shipping :	The product is shipped on dry ice/ice packs.

Gene Name :	RNASE3 ribonuclease, RNase A family, 3 [ Homo sapiens (human) ]
Official Symbol :	RNASE3
Synonyms :	RNASE3； ECP; RNS3； ribonuclease, RNase A family, 3； eosinophil cationic protein； RNase 3； ribonuclease 3； cytotoxic ribonuclease； EC 3.1.27.-
Gene ID :	6037
mRNA Refseq :	NM_002935
Protein Refseq :	NP_002926
MIM :	131398
UniProt ID :	P12724
Chromosome Location :	14q24-q31
Pathway :	Asthma
Function :	nucleic acid binding； pancreatic ribonuclease activity； ribonuclease activity

Online Inquiry