Cat.No. : |
RNASE3-5319H |
Product Overview : |
Recombinant Human Ribonuclease 3/RNASE3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Arg28-Ile160) of Human RNASE3 fused with a 6His tag at the C-terminus. |
Description : |
Ribonuclease 3 (RNASE3) is a basic protein that is localized to the eosinophil primary matrix and belongs to the pancreatic ribonuclease family. RNASE3 is released during degranulation of eosinophils. RNASE3 possesses a wide variety of biological activities. RNASE3 interacts with bacterial lipopolysaccharide (LPS) and lipoteichoic acid (LTA). RNASE3 exhibits antibacterial activity, including cytoplasmic membrane depolarization of preferentially Gram-negative, but also Gram-positive strains. It promotes E. coli outer membrane detachment, alteration of the overall cell shape and partial loss of cell content. |
Source : |
HEK293 |
Species : |
Human |
Tag : |
His |
AA Sequence : |
RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSR FRVPLLHCDLINPGAQNISNCRYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTIVDHHHHHH |
Endotoxin : |
Less than 0.1 ng/μg (1 IEU/μg). |
Purity : |
Greater than 95% as determined by reducing SDS-PAGE. |
Shipping : |
The product is shipped on dry ice/ice packs. |