Recombinant Human RNASE3, His-tagged
Cat.No. : | RNASE3-5319H |
Product Overview : | Recombinant Human Ribonuclease 3/RNASE3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Arg28-Ile160) of Human RNASE3 fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 28-160 a.a. |
Description : | Ribonuclease 3 (RNASE3) is a basic protein that is localized to the eosinophil primary matrix and belongs to the pancreatic ribonuclease family. RNASE3 is released during degranulation of eosinophils. RNASE3 possesses a wide variety of biological activities. RNASE3 interacts with bacterial lipopolysaccharide (LPS) and lipoteichoic acid (LTA). RNASE3 exhibits antibacterial activity, including cytoplasmic membrane depolarization of preferentially Gram-negative, but also Gram-positive strains. It promotes E. coli outer membrane detachment, alteration of the overall cell shape and partial loss of cell content. |
AA Sequence : | RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSR FRVPLLHCDLINPGAQNISNCRYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTIVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Shipping : | The product is shipped on dry ice/ice packs. |
Gene Name | RNASE3 ribonuclease, RNase A family, 3 [ Homo sapiens (human) ] |
Official Symbol | RNASE3 |
Synonyms | RNASE3; ECP; RNS3; ribonuclease, RNase A family, 3; eosinophil cationic protein; RNase 3; ribonuclease 3; cytotoxic ribonuclease; EC 3.1.27.- |
Gene ID | 6037 |
mRNA Refseq | NM_002935 |
Protein Refseq | NP_002926 |
MIM | 131398 |
UniProt ID | P12724 |
Chromosome Location | 14q24-q31 |
Pathway | Asthma |
Function | nucleic acid binding; pancreatic ribonuclease activity; ribonuclease activity |
◆ Recombinant Proteins | ||
RNASE3-2323H | Recombinant Human RNASE3 protein, GST-tagged | +Inquiry |
RNASE3-378H | Recombinant Human RNASE3 Protein, His-tagged | +Inquiry |
RNASE3-5319H | Recombinant Human RNASE3, His-tagged | +Inquiry |
RNASE3-379H | Recombinant Human RNASE4 Protein, His-tagged | +Inquiry |
RNASE3-370H | Recombinant Human ribonuclease, RNase A family, 3, His-tagged | +Inquiry |
◆ Native Proteins | ||
RNASE3-5318H | Native Human Ribonuclease, RNase A Family, 3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNASE3-2320HCL | Recombinant Human RNASE3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNASE3 Products
Required fields are marked with *
My Review for All RNASE3 Products
Required fields are marked with *