Recombinant Human RNASE3, His-tagged

Cat.No. : RNASE3-5319H
Product Overview : Recombinant Human Ribonuclease 3/RNASE3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Arg28-Ile160) of Human RNASE3 fused with a 6His tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 28-160 a.a.
Description : Ribonuclease 3 (RNASE3) is a basic protein that is localized to the eosinophil primary matrix and belongs to the pancreatic ribonuclease family. RNASE3 is released during degranulation of eosinophils. RNASE3 possesses a wide variety of biological activities. RNASE3 interacts with bacterial lipopolysaccharide (LPS) and lipoteichoic acid (LTA). RNASE3 exhibits antibacterial activity, including cytoplasmic membrane depolarization of preferentially Gram-negative, but also Gram-positive strains. It promotes E. coli outer membrane detachment, alteration of the overall cell shape and partial loss of cell content.
AA Sequence : RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSR FRVPLLHCDLINPGAQNISNCRYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTIVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Shipping : The product is shipped on dry ice/ice packs.
Gene Name RNASE3 ribonuclease, RNase A family, 3 [ Homo sapiens (human) ]
Official Symbol RNASE3
Synonyms RNASE3; ECP; RNS3; ribonuclease, RNase A family, 3; eosinophil cationic protein; RNase 3; ribonuclease 3; cytotoxic ribonuclease; EC 3.1.27.-
Gene ID 6037
mRNA Refseq NM_002935
Protein Refseq NP_002926
MIM 131398
UniProt ID P12724
Chromosome Location 14q24-q31
Pathway Asthma
Function nucleic acid binding; pancreatic ribonuclease activity; ribonuclease activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RNASE3 Products

Required fields are marked with *

My Review for All RNASE3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon