Recombinant Rat Tnf protein

Cat.No. : Tnf-71R
Product Overview : Recombinant Rat Tnf protein was expressed in Escherichia coli.
Description : Tumor necrosis factor alpha (TNF-α), also called cachectin, is the best-know member of the TNF-family, which can cause cell death. This protein is produced by neutrophils, activated lymphocytes, macrophages, NK cells, LAK cells, astrocytes endothelial cells, smooth muscle cells and some transformed cells. TNF-α occurs as a secreted, soluble form and as a membrane-anchored form, both of which are biologically active. The naturally-occurring form of TNF-α is glycosylated, but non-glycosylated recombinant TNF-α has comparable biological activity. Two types of receptors for TNF-α have been described and virtually all cell types studied show the presence of one or both of these receptor types.
Source : E.coli
Species : Rat
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.2, 150 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cytotoxicity assay using murine L929 cells is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 × 10⁷ IU/mg in the presence of actinomycin D.
Molecular Mass : Approximately 17.2 kDa, a single non-glycosylated polypeptide chain containing 156 amino acids.
Protein length : 156
AA Sequence : LRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL
Endotoxin : Less than 1 EU/μg of rRtTNF-α as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
SDS-PAGE of Tnf-71R :

Gene Name : Tnf
Official Symbol : Tnf
Synonyms : Tumor Necrosis Factor, TNFSF2, Cachectin, Differentiation-inducing Factor , DIF, Necrosin, Cytotoxin
Gene ID : 24835
mRNA Refseq : NM_012675
Protein Refseq : NP_036807
UniProt ID : P16599

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.