Recombinant Human FGFBP2, His-tagged FGFBP2-115H

Recombinant Human FGFBP2, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human FGFBP2, His-tagged

Recombinant Human FGFBP2, His-tagged

FGFBP2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : FGFBP2-115H
Product Overview : Recombinant Human Fibroblast Growth Factor-Binding Protein 2/FGF-BP2 is produced in human cells. The target protein is expressed with sequence (Gln20-Gly223) of Human FGFBP2 fused with a polyhistidine tag at the C-terminus.
Description : This gene encodes a member of the fibroblast growth factor binding protein family. The encoded protein is a serum protein that is selectively secreted by cytotoxic lymphocytes and may be involved in cytotoxic lymphocyte-mediated immunity. An increase in the amount of gene product may be associated with atopic asthma and mild extrinsic asthma.
Source : HEK293
Species : Human
Tag : His
Form : Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.4
AA Sequence : QAPRQKQGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLRVDCRNTDQTYWCEYRGQPSMCQAF AADPKPYWNQALQELRRLHHACQGAPVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPS LRPKATVKLTEATQLGKDSMEELGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALC AFLISFFRGLDHHHHHH
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name : FGFBP2 fibroblast growth factor binding protein 2 [ Homo sapiens(human) ]
Official Symbol : FGFBP2
Synonyms : FGFBP2; KSP37; HBP17RP; fibroblast growth factor binding protein 2; fibroblast growth factor-binding protein 2; FGF-BP2; FGFBP-2; HBp17-RP; FGF-binding protein 2; HBp17-related protein; 37 kDa killer-specific secretory protein; killer-specific secretory protein of 37 kDa
Gene ID : 83888
mRNA Refseq : NM_031950
Protein Refseq : NP_114156
MIM : 607713
UniProt ID : Q9BYJ0
Chromosome Location : 4p16
Function : growth factor binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy