"FGFBP2" Related Products

Recombinant Human FGFBP2, His-tagged

Cat.No.: FGFBP2-115H
Product Overview: Recombinant Human Fibroblast Growth Factor-Binding Protein 2/FGF-BP2 is produced in human cells. The target protein is expressed with sequence (Gln20-Gly223) of Human FGFBP2 fused with a polyhistidine tag at the C-terminus.
Description: This gene encodes a member of the fibroblast growth factor binding protein family. The encoded protein is a serum protein that is selectively secreted by cytotoxic lymphocytes and may be involved in cytotoxic lymphocyte-mediated immunity. An increase in the amount of gene product may be associated with atopic asthma and mild extrinsic asthma.
Source: HEK293
Species: Human
Tag: His
Form: Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.4
AA Sequence: QAPRQKQGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLRVDCRNTDQTYWCEYRGQPSMCQAF AADPKPYWNQALQELRRLHHACQGAPVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPS LRPKATVKLTEATQLGKDSMEELGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALC AFLISFFRGLDHHHHHH
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name: FGFBP2 fibroblast growth factor binding protein 2 [ Homo sapiens(human) ]
Official Symbol: FGFBP2
Synonyms: FGFBP2; KSP37; HBP17RP; fibroblast growth factor binding protein 2; fibroblast growth factor-binding protein 2; FGF-BP2; FGFBP-2; HBp17-RP; FGF-binding protein 2; HBp17-related protein; 37 kDa killer-specific secretory protein; killer-specific secretory protein of 37 kDa
Gene ID: 83888
mRNA Refseq: NM_031950
Protein Refseq: NP_114156
MIM: 607713
UniProt ID: Q9BYJ0
Chromosome Location: 4p16
Function: growth factor binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.