Recombinant Full Length Human FGFBP2 Protein, C-Flag-tagged
Cat.No. : | FGFBP2-1230HFL |
Product Overview : | Recombinant Full Length Human FGFBP2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the fibroblast growth factor binding protein family. The encoded protein is a serum protein that is selectively secreted by cytotoxic lymphocytes and may be involved in cytotoxic lymphocyte-mediated immunity. An increase in the amount of gene product may be associated with atopic asthma and mild extrinsic asthma. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 22.5 kDa |
AA Sequence : | MKFVPCLLLVTLSCLGTLGQAPRQKQGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLRVDCRNTDQTY WCEYRGQPSMCQAFAADPKPYWNQALQELRRLHHACQGAPVLRPSVCREAGPQAHMQQVTSSLKGSPEPN QQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPF QALCAFLISFFRGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | FGFBP2 fibroblast growth factor binding protein 2 [ Homo sapiens (human) ] |
Official Symbol | FGFBP2 |
Synonyms | KSP37; HBP17RP |
Gene ID | 83888 |
mRNA Refseq | NM_031950.4 |
Protein Refseq | NP_114156.1 |
MIM | 607713 |
UniProt ID | Q9BYJ0 |
◆ Recombinant Proteins | ||
FGFBP2-6017C | Recombinant Chicken FGFBP2 | +Inquiry |
FGFBP2-4842HF | Recombinant Full Length Human FGFBP2 Protein, GST-tagged | +Inquiry |
FGFBP2-909H | Recombinant Human FGFBP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FGFBP2-115H | Recombinant Human FGFBP2 protein(Met1-Gly223), His-tagged | +Inquiry |
FGFBP2-1703R | Recombinant Rhesus monkey FGFBP2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGFBP2-6232HCL | Recombinant Human FGFBP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGFBP2 Products
Required fields are marked with *
My Review for All FGFBP2 Products
Required fields are marked with *
0
Inquiry Basket