"BSG" Related Products

Expand
Expand
Expand

Recombinant Human BSG, GST-tagged

Cat.No.: BSG-105H
Product Overview: Human BSG full-length ORF ( 1 a.a. - 269 a.a.) recombinant protein with GST-tag at N-terminal.
Description: The protein encoded by this gene is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. The encoded protein is also a member of the immunoglobulin superfamily. Multiple transcript variants encoding different isoforms have been found for this gene.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 55.6 kDa
AA Sequence: MAAALFVLLGFALLGTHGASGAAGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFK VDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINE GETAMLVCKSESVPPVTDWAWYKITDSEDKA LMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVT IIFIYEKRRKPE DVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: BSG basigin (Ok blood group) [ Homo sapiens (human) ]
Official Symbol: BSG
Synonyms: BSG; M6; OK; 5F7; TCSF; CD147; EMMPRIN; basigin (Ok blood group); basigin; CD147 antigen; OK blood group antigen; collagenase stimulatory factor; leukocyte activation antigen M6; extracellular matrix metalloproteinase inducer; tumor cell-derived collagenase stimulatory factor
Gene ID: 682
mRNA Refseq: NM_198589
Protein Refseq: NP_940991
MIM: 109480
UniProt ID: P35613
Chromosome Location: 19p13.3
Pathway: Basigin interactions; Cell surface interactions at the vascular wall; Integrin cell surface interactions
Function: mannose binding; protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.