"COL1A2" Related Products

Expand

Recombinant Human COL1A2, GST-tagged

Cat.No.: COL1A2-115H?
Product Overview: Human COL1A2 partial ORF ( AAH54498.1, 1257 a.a. - 1366 a.a.) recombinant protein with GST-tag at N-terminal.
Description: This gene encodes the pro-alpha2 chain of type I collagen whose triple helix comprises two alpha1 chains and one alpha2 chain. Type I is a fibril-forming collagen found in most connective tissues and is abundant in bone, cornea, dermis and tendon. Mutations in this gene are associated with osteogenesis imperfecta types I-IV, Ehlers-Danlos syndrome type VIIB, recessive Ehlers-Danlos syndrome Classical type, idiopathic osteoporosis, and atypical Marfan syndrome. Symptoms associated with mutations in this gene, however, tend to be less severe than mutations in the gene for the alpha1 chain of type I collagen (COL1A1) reflecting the different role of alpha2 chains in matrix integrity. Three transcripts, resulting from the use of alternate polyadenylation signals, have been identified for this gene.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 37.95 kDa
AA Sequence: MRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEY KTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: COL1A2?collagen, type I, alpha 2 [?Homo sapiens?(human) ]
Official Symbol: COL1A2
Synonyms: COL1A2; OI4; collagen, type I, alpha 2; collagen alpha-2(I) chain; type I procollagen; alpha 2(I)-collagen; alpha-2 type I collagen; collagen I, alpha-2 polypeptide; collagen of skin, tendon and bone, alpha-2 chain
Gene ID: 1278
mRNA Refseq: NM_000089
Protein Refseq: NP_000080
MIM: 120160
UniProt ID: P08123
Chromosome Location: 7q22.1
Pathway: Binding and Uptake of Ligands by Scavenger Receptors; ECM-receptor interaction; Focal Adhesion
Function: extracellular matrix structural constituent; identical protein binding; metal ion binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.