"ST3GAL3" Related Products

Expand
Expand

Recombinant Human ST3GAL3, GST-tagged

Cat.No.: ST3GAL3-234H
Product Overview: Recombinant Human ST3GAL3 (1 a.a. - 390 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Mutations in this gene have been associated with autosomal recessive nonsymdromic mental retardation-12 (MRT12). Multiple transcript variants encoding several different isoforms have been found for this gene.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 70.2 kDa
AA Sequence: MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEEDSSKYSHSSSPQEKPVADSVVLSFDSAGQTLGSEYDRL GFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNL IKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYP EGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLI GLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLR KLVKARVITDLSSGI
Applications: ELISA; WB-Re; AP; Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: ST3GAL3 ST3 beta-galactoside alpha-2,3-sialyltransferase 3 [ Homo sapiens (human) ]
Official Symbol: ST3GAL3
Synonyms: ST3GAL3; ST3N; MRT12; SIAT6; EIEE15; ST3GALII; ST3GalIII; ST3 beta-galactoside alpha-2,3-sialyltransferase 3; CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase; ST3Gal III; alpha 2,3-ST 3; alpha-2,3-sialyltransferase II; alpha 2,3-sialyltransferase III; Gal beta-1,3(4)GlcNAc alpha-2,3 sialyltransferase; sialyltransferase 6 (N-acetyllacosaminide alpha 2,3-sialyltransferase); NP_001257388.1; NP_001257389.1; NP_001257390.1; NP_001257391.1; NP_001257392.1; NP_001257393.1; NP_001257394.1; EC 2.4.99.6; NP_001257395.1; NP_006270.1; NP_777623.2; NP_777624.1; NP_777625.1; NP_777626.1; NP_777627.1; NP_777628.2; NP_777629.1; NP_777630.1; NP_777631.2
Gene ID: 6487
mRNA Refseq: NM_174964
Protein Refseq: NP_777624
MIM: 606494
UniProt ID: Q11203
Chromosome Location: 1p34.1
Pathway: Glycosaminoglycan biosynthesis - keratan sulfate; Glycosphingolipid biosynthesis - lacto and neolacto series; MPS I - Hurler syndrome
Function: N-acetyllactosaminide alpha-2,3-sialyltransferase activity; beta-galactoside (CMP) alpha-2,3-sialyltransferase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.