Recombinant Human ST3GAL3 Protein (AA 60-375), N-6×His/GFP tagged

Cat.No. : ST3GAL3-12H
Product Overview : Recombinant Human ST3GAL3 Protein (AA 60-375) with N-6×His/GFP tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : GFP&His
Protein Length : AA 60-375
Description : The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Mutations in this gene have been associated with a form of autosomal recessive nonsymdromic cognitive disability as well as infantile epileptic encephalopathy. Multiple transcript variants encoding several different isoforms have been found for this gene.
Molecular Mass : ~60-70 kDa
AA Sequence : ELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI
Purity : >95%, by SDS-PAGE as visualized by Coomassie Blue Staining
Stability : 6 months if stored at -80 centigrade. Avoid repeated freeze thaws.
Concentration : 1 mg/mL
Storage Buffer : Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol.
Preservative : 0.05 % NaN3
Shipping : This product is shipped as 0.2μm filtered product on dry ice.
Gene Name ST3GAL3 ST3 beta-galactoside alpha-2,3-sialyltransferase 3 [ Homo sapiens (human) ]
Official Symbol ST3GAL3
Synonyms ST3GAL3; ST3 beta-galactoside alpha-2,3-sialyltransferase 3; sialyltransferase 6 (N acetyllacosaminide alpha 2,3 sialyltransferase) , SIAT6; CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase; ST3Gal III; alpha 2,3-ST 3; alpha-2,3-sialyltransferase II; alpha 2,3-sialyltransferase III; Gal beta-1,3(4)GlcNAc alpha-2,3 sialyltransferase; sialyltransferase 6 (N-acetyllacosaminide alpha 2,3-sialyltransferase); ST3N; MRT12; SIAT6; ST3GALII; ST3GalIII;
Gene ID 6487
mRNA Refseq NM_001270459
Protein Refseq NP_001257388
MIM 606494
UniProt ID Q11203

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ST3GAL3 Products

Required fields are marked with *

My Review for All ST3GAL3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon