Recombinant Human ST3GAL3 Protein (AA 60-375), N-6×His/GFP tagged
| Cat.No. : | ST3GAL3-12H |
| Product Overview : | Recombinant Human ST3GAL3 Protein (AA 60-375) with N-6×His/GFP tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | GFP&His |
| Protein Length : | AA 60-375 |
| Description : | The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Mutations in this gene have been associated with a form of autosomal recessive nonsymdromic cognitive disability as well as infantile epileptic encephalopathy. Multiple transcript variants encoding several different isoforms have been found for this gene. |
| Molecular Mass : | ~60-70 kDa |
| AA Sequence : | ELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI |
| Purity : | >95%, by SDS-PAGE as visualized by Coomassie Blue Staining |
| Stability : | 6 months if stored at -80 centigrade. Avoid repeated freeze thaws. |
| Concentration : | 1 mg/mL |
| Storage Buffer : | Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol. |
| Preservative : | 0.05 % NaN3 |
| Shipping : | This product is shipped as 0.2μm filtered product on dry ice. |
| Gene Name | ST3GAL3 ST3 beta-galactoside alpha-2,3-sialyltransferase 3 [ Homo sapiens (human) ] |
| Official Symbol | ST3GAL3 |
| Synonyms | ST3GAL3; ST3 beta-galactoside alpha-2,3-sialyltransferase 3; sialyltransferase 6 (N acetyllacosaminide alpha 2,3 sialyltransferase) , SIAT6; CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase; ST3Gal III; alpha 2,3-ST 3; alpha-2,3-sialyltransferase II; alpha 2,3-sialyltransferase III; Gal beta-1,3(4)GlcNAc alpha-2,3 sialyltransferase; sialyltransferase 6 (N-acetyllacosaminide alpha 2,3-sialyltransferase); ST3N; MRT12; SIAT6; ST3GALII; ST3GalIII; |
| Gene ID | 6487 |
| mRNA Refseq | NM_001270459 |
| Protein Refseq | NP_001257388 |
| MIM | 606494 |
| UniProt ID | Q11203 |
| ◆ Recombinant Proteins | ||
| ST3GAL3-12H | Recombinant Human ST3GAL3 Protein (AA 60-375), N-6×His/GFP tagged | +Inquiry |
| ST3GAL3-232H | Recombinant Human ST3GAL3, His-tagged | +Inquiry |
| ST3GAL3-8760M | Recombinant Mouse ST3GAL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL509MF | Recombinant Full Length Mouse Cmp-N-Acetylneuraminate-Beta-1,4-Galactoside Alpha-2,3-Sialyltransferase(St3Gal3) Protein, His-Tagged | +Inquiry |
| ST3GAL3-234H | Recombinant Human ST3GAL3, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ST3GAL3-1441HCL | Recombinant Human ST3GAL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ST3GAL3 Products
Required fields are marked with *
My Review for All ST3GAL3 Products
Required fields are marked with *
