Recombinant Human P2RY10 protein, GST-tagged

• Cat.No.: P2RY10-1495H
• Product Overview: Recombinant Human P2RY10 protein(171-339 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 171-339 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: RSTDLNNNKSCFADLGYKQMNAVALVGMITVAELAGFVIPVIIIAWCTWKTTISLRQPPMAFQGISERQKALRMVFMCAAVFFICFTPYHINFIFYTMVKETIISSCPVVRIALYFHPFCLCLASLCCLLDPILYYFMASEFRDQLSRHGSSVTRSRLMSKESGSSMIG
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: P2RY10 purinergic receptor P2Y, G-protein coupled, 10 [ Homo sapiens (human) ]
• Official Symbol: P2RY10
• Synonyms: P2RY10; P2Y10; purinergic receptor P2Y, G-protein coupled, 10; putative P2Y purinoceptor 10; P2Y-like receptor; P2Y purinoceptor 10; G-protein coupled purinergic receptor P2Y10
• Gene ID: 27334
• mRNA Refseq: NM_014499
• Protein Refseq: NP_055314
• MIM: 300529
• UniProt ID: O00398