Recombinant Human P2RY10 protein, GST-tagged
| Cat.No. : | P2RY10-1495H |
| Product Overview : | Recombinant Human P2RY10 protein(171-339 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | January 31, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 171-339 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | RSTDLNNNKSCFADLGYKQMNAVALVGMITVAELAGFVIPVIIIAWCTWKTTISLRQPPMAFQGISERQKALRMVFMCAAVFFICFTPYHINFIFYTMVKETIISSCPVVRIALYFHPFCLCLASLCCLLDPILYYFMASEFRDQLSRHGSSVTRSRLMSKESGSSMIG |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | P2RY10 purinergic receptor P2Y, G-protein coupled, 10 [ Homo sapiens (human) ] |
| Official Symbol | P2RY10 |
| Synonyms | P2RY10; P2Y10; purinergic receptor P2Y, G-protein coupled, 10; putative P2Y purinoceptor 10; P2Y-like receptor; P2Y purinoceptor 10; G-protein coupled purinergic receptor P2Y10 |
| Gene ID | 27334 |
| mRNA Refseq | NM_014499 |
| Protein Refseq | NP_055314 |
| MIM | 300529 |
| UniProt ID | O00398 |
| ◆ Recombinant Proteins | ||
| P2RY10-6458M | Recombinant Mouse P2RY10 Protein, His (Fc)-Avi-tagged | +Inquiry |
| P2RY10-1495H | Recombinant Human P2RY10 protein, GST-tagged | +Inquiry |
| P2RY10-12273M | Recombinant Mouse P2RY10 Protein | +Inquiry |
| RFL22354HF | Recombinant Full Length Human Putative P2Y Purinoceptor 10(P2Ry10) Protein, His-Tagged | +Inquiry |
| P2RY10-3088R | Recombinant Rhesus Macaque P2RY10 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| P2RY10-3494HCL | Recombinant Human P2RY10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All P2RY10 Products
Required fields are marked with *
My Review for All P2RY10 Products
Required fields are marked with *
