Recombinant Human RAD51L1 protein, His-tagged

Cat.No. : RAD51L1-2157H
Product Overview : Recombinant Human RAD51L1 (1-384aa) fussed with His tag at N-terminal was expressed in E. coli.
Availability July 01, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-384aa
Form : 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), added with 300 mM Imidazole and 0.7% sarcosyl, 15% glycerol.
Molecular Mass : 47 kDa
AA Sequence : MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRACAPKMQTAYGIKAQRS ADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAE RLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQ GNLKERNKFLAREASSLKYLAEEFSIPVIL
Stability : Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
Shipping : The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.
Gene Name RAD51B RAD51 homolog B (S. cerevisiae) [ Homo sapiens ]
Official Symbol RAD51B
Synonyms RAD51B; RAD51 homolog B (S. cerevisiae); RAD51 (S. cerevisiae) like 1 , RAD51 like 1 (S. cerevisiae) , RAD51L1; DNA repair protein RAD51 homolog 2; hREC2; R51H2; REC2; RecA-like protein; recombination repair protein; RAD51L1; MGC34245;
Gene ID 5890
mRNA Refseq NM_002877
Protein Refseq NP_002868
MIM 602948
UniProt ID O15315
Chromosome Location 14q23-q24.2
Pathway Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; Homologous recombination, organism-specific biosystem; Homologous recombination, conserved biosystem;
Function ATP binding; DNA binding; DNA-dependent ATPase activity; nucleoside-triphosphatase activity; nucleotide binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAD51B Products

Required fields are marked with *

My Review for All RAD51B Products

Required fields are marked with *

0
cart-icon