"RAD51B" Related Products

Recombinant Human RAD51L1 protein, His-tagged

Cat.No.: RAD51L1-2157H
Product Overview: Recombinant Human RAD51L1 (1-384aa) fussed with His tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: His
Form: 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), added with 300 mM Imidazole and 0.7% sarcosyl, 15% glycerol.
Molecular Mass: 47 kDa
Protein length: 1-384aa
AA Sequence: MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRACAPKMQTAYGIKAQRS ADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAE RLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQ GNLKERNKFLAREASSLKYLAEEFSIPVIL
Stability: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
Shipping: The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.
Gene Name: RAD51B RAD51 homolog B (S. cerevisiae) [ Homo sapiens ]
Official Symbol: RAD51B
Synonyms: RAD51B; RAD51 homolog B (S. cerevisiae); RAD51 (S. cerevisiae) like 1 , RAD51 like 1 (S. cerevisiae) , RAD51L1; DNA repair protein RAD51 homolog 2; hREC2; R51H2; REC2; RecA-like protein; recombination repair protein; RAD51L1; MGC34245;
Gene ID: 5890
mRNA Refseq: NM_002877
Protein Refseq: NP_002868
MIM: 602948
UniProt ID: O15315
Chromosome Location: 14q23-q24.2
Pathway: Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; Homologous recombination, organism-specific biosystem; Homologous recombination, conserved biosystem;
Function: ATP binding; DNA binding; DNA-dependent ATPase activity; nucleoside-triphosphatase activity; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.