Recombinant Human RAD51L1 protein, His-tagged
Cat.No. : | RAD51L1-2157H |
Product Overview : | Recombinant Human RAD51L1 (1-384aa) fussed with His tag at N-terminal was expressed in E. coli. |
Availability | October 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-384aa |
Form : | 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), added with 300 mM Imidazole and 0.7% sarcosyl, 15% glycerol. |
Molecular Mass : | 47 kDa |
AA Sequence : | MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRACAPKMQTAYGIKAQRS ADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAE RLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQ GNLKERNKFLAREASSLKYLAEEFSIPVIL |
Stability : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
Shipping : | The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade. |
Gene Name | RAD51B RAD51 homolog B (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | RAD51B |
Synonyms | RAD51B; RAD51 homolog B (S. cerevisiae); RAD51 (S. cerevisiae) like 1 , RAD51 like 1 (S. cerevisiae) , RAD51L1; DNA repair protein RAD51 homolog 2; hREC2; R51H2; REC2; RecA-like protein; recombination repair protein; RAD51L1; MGC34245; |
Gene ID | 5890 |
mRNA Refseq | NM_002877 |
Protein Refseq | NP_002868 |
MIM | 602948 |
UniProt ID | O15315 |
Chromosome Location | 14q23-q24.2 |
Pathway | Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; Homologous recombination, organism-specific biosystem; Homologous recombination, conserved biosystem; |
Function | ATP binding; DNA binding; DNA-dependent ATPase activity; nucleoside-triphosphatase activity; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
RAD51B-12585Z | Recombinant Zebrafish RAD51B | +Inquiry |
Rad51b-6781M | Recombinant Mouse Rad51b Protein (Met121-Pro350), N-His tagged | +Inquiry |
RAD51B-2465H | Recombinant human RAD51B, His-tagged | +Inquiry |
RAD51B-121H | Recombinant Human RAD51B protein, T7/His-tagged | +Inquiry |
RAD51L1-2157H | Recombinant Human RAD51L1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAD51B-2554HCL | Recombinant Human RAD51L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAD51B Products
Required fields are marked with *
My Review for All RAD51B Products
Required fields are marked with *