Recombinant Human REDD1 protein
| Cat.No. : | REDD1-2245H |
| Product Overview : | Recombinant Human REDD1 (1 - 232 aa) was expressed in E. coli. |
| Availability | June 07, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1 - 232 aa |
| Form : | 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol. |
| Molecular Mass : | 51 kDa |
| AA Sequence : | MPSLWDRFSSSSTSSSPSSLPRTPTPDRPPRSAWGSATREEGFDRSTSLESSDCESLDSSNSGFGPEEDTAYLDG VSLPDFELLSDPEDEHLCANLMQLLQESLAQARLGSRRPARLLMPSQLVSQVGKELLRLAYSEPCGLRGALLDVC VEQGKSCHSVGQLALDPSLVPTFQLTLVLRLDSRLWPKIQGLFSSANSPFLPGFSQSLTLSTGFRVIKKKLYSSE QLLIEEC |
| Stability : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
| Shipping : | The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade. |
| Gene Name | DDIT4 DNA-damage-inducible transcript 4 [ Homo sapiens ] |
| Official Symbol | DDIT4 |
| Synonyms | DDIT4; DNA-damage-inducible transcript 4; DNA damage-inducible transcript 4 protein; Dig2; FLJ20500; HIF 1 responsive RTP801; REDD 1; REDD1; RTP801; HIF-1 responsive protein RTP801; HIF-1 responsive RTP801 (RTP801); protein regulated in development and DNA damage response 1; REDD-1; RP11-442H21.1; |
| Gene ID | 54541 |
| mRNA Refseq | NM_019058 |
| Protein Refseq | NP_061931 |
| MIM | 607729 |
| UniProt ID | Q9NX09 |
| Chromosome Location | 10q22.1 |
| Pathway | Direct p53 effectors, organism-specific biosystem; mTOR signaling pathway, organism-specific biosystem; mTOR signaling pathway, organism-specific biosystem; mTOR signaling pathway, conserved biosystem; |
| Function | 14-3-3 protein binding; |
| ◆ Recombinant Proteins | ||
| DDIT4-1207R | Recombinant Rhesus monkey DDIT4 Protein, His-tagged | +Inquiry |
| DDIT4-2445H | Recombinant Human DDIT4 Protein, GST-tagged | +Inquiry |
| DDIT4-1032R | Recombinant Rhesus Macaque DDIT4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DDIT4-1469R | Recombinant Rat DDIT4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DDIT4-10459Z | Recombinant Zebrafish DDIT4 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DDIT4-7026HCL | Recombinant Human DDIT4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDIT4 Products
Required fields are marked with *
My Review for All DDIT4 Products
Required fields are marked with *
