Recombinant human IFNA2, Active, His-tagged
| Cat.No. : | IFNA2-1554H |
| Product Overview : | Recombinant human IFN-alpha-2a is a polypeptide single chain containing 171 amino acids with a predicted molecular mass of 20.1 kDa. Recombinant human IFN-alpha-2 contains a His-tag at the C-terminal end. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Nicotiana Benthamiana |
| Tag : | His |
| Protein Length : | 171 a.a. |
| Description : | Interferon alpha 2a is an interferon class I produced by the cells of the innate immune system as a part of the defense response to foreign agents such as viruses, parasites and tumour cells. The human alpha-interferon family displays broad spectrum antiviral, antiproliferative and immunomodulatory activities on a variety of cell types. Interferon Alpha-2a (IFNa-2a), one of the subtypes, is a protein consisting of 165 amino acid. Its three-dimensional loop structure is maintained by two disulphide bridges. It has an approximate molecular weight of 20 kDa. |
| Form : | Recombinant human Interferon alpha 2a is lyophilized from a Tris HCl 0.05M buffer at pH 7.4 and 0.01% SDS. |
| Molecular Mass : | 20.1 kDa |
| AA Sequence : | CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAA WDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRS FSLSTNLQESLRSKEHHHHHH |
| Endotoxin : | < 0.04="" eu/μg="" protein="" (lal=""> |
| Purity : | >97% by SDS-PAGE gel |
| Storage : | This lyophilized preparation is stable at 2-8o C for short term, long storage it should be kept at -20oC. Reconstituted protein should be stored in working aliquots at –20°C. Repeated freezing and thawing is not recommended. |
| Reconstitution : | Centrifuge vial before opening. Lyophilized protein should be reconstituted in water to a concentration of 50 ng/μl. Optimal concentration should be determined for specific application and cell lines. |
| Gene Name | IFNA2 interferon, alpha 2 [ Homo sapiens ] |
| Official Symbol | IFNA2 |
| Synonyms | IFNA2; interferon, alpha 2; interferon alpha-2; alpha 2a interferon; IFN alphaA; IFNA; interferon alpha 2b; interferon alpha A; leIF A; IFN-alpha-2; alpha-2a interferon; INFA2; IFNA2B; IFN-alphaA; MGC125764; MGC125765; |
| Gene ID | 3440 |
| mRNA Refseq | NM_000605 |
| Protein Refseq | NP_000596 |
| MIM | 147562 |
| UniProt ID | P01563 |
| Chromosome Location | 9p22 |
| Pathway | Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem; |
| Function | cytokine activity; interferon-alpha/beta receptor binding; protein binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNA2 Products
Required fields are marked with *
My Review for All IFNA2 Products
Required fields are marked with *



