"IL4" Related Products

Recombinant human IL4, Active, His-tagged

Cat.No.: IL4-1557H
Product Overview: Recombinant human Interleukin-4 is a polypeptide chain containing 137 amino acids (25 – 153 of P05112 IL4_HUMAN) and 8 aa Histidine-based tag. It has a predicted molecular mass of 16kDa, however as result of potential glycosylation, the recombinant protein could migrate with an apparent molecular mass of 16-18 kDa in SDS-PAGE gel.
Description: Interleukin-4 (IL-4) is a pleiotropic cytokine that regulates diverse T and B cell responses including differentiation of naive T cells into the TH2 phenotype, promoting B cell proliferation, antibody isotype switching, and expression of other TH2 cytokines including IL-5 and IL-9. IL-4 plays a critical role in the development of allergic inflammation and asthma.It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. IL-4 is produced primarily by activated CD4+ T-lymphocytes, NK 1.1+ T-cells (NKT), mast cells and basophils.One major role of IL-4 is priming the differentiation of precursor CD4+ T-cells into Th2 effector cells by altering their cytokine expression during activation.IL-4 has also been shown to have other stimulatory effects on B-cells including increased expression of CD23, IL-4R, IgM and MHC class II molecules on their surface.
Source: Human recombinant protein expressed in Nicotiana benthamiana. It is produced by transient expression in non-transgenic plants. This product contains no animal–derived components or impurities. Animal Free product.
Species: Human
Tag: His
Form: Recombinant human IL-4 is lyophilized from 10mM Phosphate Potasium buffer pH 7.5 and 100 mM NaCl.
Molecular Mass: 16kDa, apparent molecular mass of 16-18 kDa in SDS-PAGE gel.
AA Sequence: HHHHHHHHHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLG ATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
Endotoxin: < 0.04 eu/μg protein (lal>
Purity: >97% by SDS-PAGE gel
Storage: This lyophilized preparation is stable at 2-8o C for short term, long storage it should be kept at -20oC. Reconstituted protein should be stored in working aliquots at –20°C. Repeated freezing and thawing is not recommended.
Reconstitution: Centrifuge vial before opening. Lyophilized protein should be reconstituted in water to a concentration of 100 ng/μl. When reconstituting the product, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. Optimal concentration should be determined for specific application and cell lines.
Gene Name: IL4 interleukin 4 [ Homo sapiens ]
Official Symbol: IL4
Synonyms: IL4; interleukin 4; interleukin-4; B cell growth factor 1; B_cell stimulatory factor 1; BCGF 1; BCGF1; BSF1; IL 4; lymphocyte stimulatory factor 1; MGC79402; binetrakin; pitrakinra; IL-4; BSF-1; BCGF-1;
Gene ID: 3565
mRNA Refseq: NM_000589
Protein Refseq: NP_000580
MIM: 147780
UniProt ID: P05112
Chromosome Location: 5q23-q31
Pathway: Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Asthma, organism-specific biosystem; Asthma, conserved biosystem; Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; CD40/CD40L signaling, organism-specific biosystem;
Function: cytokine activity; growth factor activity; interleukin-4 receptor binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.