Recombinant Human VDR protein, His-tagged

• Cat.No.: VDR-3659H
• Product Overview: Recombinant Human VDR protein(79-427 aa) is expressed from E.coli with His tag at the N-Terminus.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 79-427 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AASequence: CRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLEVFGNEIS
• Purity: 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• Publications:
  • The functional role of the cell adhesion molecule L1 in mitochondrial metabolism and dynamics and the functional consequences of L1´s interaction with nuclear receptors in the murine central nervous system (2017)
  • A Fragment of Adhesion Molecule L1 Binds to Nuclear Receptors to Regulate Synaptic Plasticity and Motor Coordination (2018)

Gene Information

• Gene Name: VDR vitamin D (1,25- dihydroxyvitamin D3) receptor [ Homo sapiens ]
• Official Symbol: VDR
• Synonyms: VDR; vitamin D (1,25- dihydroxyvitamin D3) receptor; vitamin D3 receptor; NR1I1; 1,25-dihydroxyvitamin D3 receptor; vitamin D nuclear receptor variant 1; nuclear receptor subfamily 1 group I member 1
• Gene ID: 7421
• mRNA Refseq: NM_000376
• Protein Refseq: NP_000367
• MIM: 601769
• UniProt ID: P11473