Recombinant Human VDR protein, His-tagged
| Cat.No. : | VDR-3659H |
| Product Overview : | Recombinant Human VDR protein(79-427 aa) is expressed from E.coli with His tag at the N-Terminus. |
| Availability | September 16, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 79-427 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | CRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLEVFGNEIS |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| Publications : |
|
| Gene Name | VDR vitamin D (1,25- dihydroxyvitamin D3) receptor [ Homo sapiens ] |
| Official Symbol | VDR |
| Synonyms | VDR; vitamin D (1,25- dihydroxyvitamin D3) receptor; vitamin D3 receptor; NR1I1; 1,25-dihydroxyvitamin D3 receptor; vitamin D nuclear receptor variant 1; nuclear receptor subfamily 1 group I member 1; |
| Gene ID | 7421 |
| mRNA Refseq | NM_000376 |
| Protein Refseq | NP_000367 |
| MIM | 601769 |
| UniProt ID | P11473 |
| ◆ Recombinant Proteins | ||
| VDR-2516H | Active Recombinant Human Vitamin D (1,25- dihydroxyvitamin D3) Receptor | +Inquiry |
| Vdr-7422M | Recombinant Mouse Vdr protein(Met1-Ser422), His-tagged | +Inquiry |
| VDR-6513R | Recombinant Rat VDR Protein | +Inquiry |
| VDR-200H | Recombinant Human VDR protein, T7/His-tagged | +Inquiry |
| VDR-2560H | Recombinant Human VDR, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VDR-001MCL | Recombinant Mouse VDR cell lysate | +Inquiry |
| VDR-462HCL | Recombinant Human VDR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VDR Products
Required fields are marked with *
My Review for All VDR Products
Required fields are marked with *
