"WNT5A" Related Products

Expand
Expand

Recombinant Human WNT5A, StrepII-tagged

Cat.No.: WNT5A-206H
Product Overview: Purified, full-length human recombinant WNT5A protein (amino acids 36-380, 345 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 38.8 kDa. (Accession NP_003353.2; UniProt P41221)
Description: The WNT family consists of structurally related signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This protein is a member of the WNT family that signals through both the canonical and non-canonical WNT pathways. It is a ligand for the seven transmembrane receptor frizzled-5 and the tyrosine kinase orphan receptor 2. This protein plays an essential role in regulating developmental pathways during embryogenesis. This protein may also play a role in oncogenesis.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 36-380, 345 a.a.
AA Sequence: FAQVVIEANSWWSLGMNNPVQMSEVYIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRH RRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWGGCGDN IDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFR KVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGE LMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEIVDQFVCK
Endotoxin: <0.1 eu per ug protein by lal
Purity: >95% pure by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: WNT5A wingless-type MMTV integration site family, member 5A [ Homo sapiens ]
Official Symbol: WNT5A
Synonyms: WNT5A; wingless-type MMTV integration site family, member 5A; protein Wnt-5a; hWNT5A; WNT 5A protein; WNT-5A protein;
Gene ID: 7474
mRNA Refseq: NM_001256105
Protein Refseq: NP_001243034
MIM: 164975
UniProt ID: P41221
Chromosome Location: 3p21-p14
Pathway: Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem;
Function: cytokine activity; frizzled binding; frizzled-2 binding; protein domain specific binding; receptor agonist activity; receptor binding; receptor tyrosine kinase-like orphan receptor binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.