"IL15" Related Products

Expand
Expand
Expand

Recombinant Human IL15, StrepII-tagged

Cat.No.: IL15-270H
Product Overview: Purified, full-length human recombinant IL15 protein (amino acids 30-162, 133 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 14.7 kDa. (Accession NP_000576; UniProt P40933)
Description: IL15 is a cytokine that regulates T and natural killer cell activation and proliferation. IL15 and IL2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other"s activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 30-162, 133 a.a.
AA Sequence: GIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGD ASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Endotoxin: <0.1 eu per ug protein by lal
Purity: >80% by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: IL15 interleukin 15 [ Homo sapiens ]
Official Symbol: IL15
Synonyms: IL15; interleukin 15; interleukin-15; IL 15; MGC9721; IL-15;
Gene ID: 3600
mRNA Refseq: NM_000585
Protein Refseq: NP_000576
MIM: 600554
UniProt ID: P40933
Chromosome Location: 4q31
Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem;
Function: cytokine activity; cytokine receptor binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.