"Il19" Related Products

Expand

Recombinant Mouse Il19 protein

Cat.No. : Il19-72M
Product Overview : Recombinant Mouse Il19 protein was expressed in Escherichia coli.
Description : Interleukin-19 (IL-19) belongs to the IL-10 family that includes IL-10, IL-20, IL-22, IL-24, and IL-26. As a monomer made of seven amphipathic helices, IL-19 has a helical bundle and shares the same cell surface receptor (IL-20R) with IL-20 and IL-24. It may play some important roles in inflammatory responses because it up-regulates IL-6 and TNF-alpha and induces apoptosis.
Source : E.coli
Species : Mouse
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, with 3 % Trehalose.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human IL-20Rα and human IL-20Rβ co-transfected murine BaF3 pro-B cells is less than 0.8 ng/ml, corresponding to a specific activity of > 1.25 × 10⁶ IU/mg.
Molecular Mass : Approximately 17.6 kDa, a single non-glycosylated polypeptide chain containing 152 amino acids.
Protein length : 152
AA Sequence : LRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA
Endotoxin : Less than 0.1 EU/µg of rMuIL-19 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
SDS-PAGE of Il19-72M :

Gene Name : Il19
Official Symbol : Il19
Synonyms : IL19; interleukin 19; interleukin-19; IL-19;
Gene ID : 329244
mRNA Refseq : NM_001009940
Protein Refseq : NP_001009940
UniProt ID : Q8CJ70

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.