"IFNg" Related Products

Recombinant Rabbit IFN gamma

Cat.No.: IFNg-28R
Product Overview: Rabbit IFN gamma was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.
Description: Interferon-gamma (IFN-gamma) is a dimerized soluble cytokine that is the only member of the type II class of interferons. This interferon was originally called macrophage-activating factor, a term now used to describe a larger family of proteins to which IFN-gamma belongs. IFN-gamma, or type II interferon, is a cytokine that is critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Aberrant IFN-gamma expression is associated with a number of autoinflammatory and autoimmune diseases. The importance of IFN-gamma in the immune system stems in part from its ability to inhibit viral replication directly, but, most important, derives from its immunostimulatory and immunomodulatory effects. IFN-gamma is produced predominantly by natural killer (NK) and natural killer T (NKT) cells as part of the innate immune response, and by CD4 and CD8 cytotoxic T lymphocyte (CTL) effector T cells once antigen-specific immunity develops.
Source: Yeast
Species: Rabbit
Form: Lyophilized
Molecular Mass: 16.9 kDa
AA Sequence: QDTLTRETEHLKAYLKANTSDVANGGPLFLNILRNWKEESDNKIIQSQIVS FYFKLFDNLKDHEVIKKSMESIKEDIFVKFFNSNLTKMDDFQNL TRISVDDRLVQRKAVSELSNVLNFLSPKSNLKKRKRSQTLFRG RRASKY (144)
Applications: The rabbit IFN gamma protein can be used in cell culture, as a IFN gamma ELISA Standard, and as a Western Blot Control.
Storage: -20 C
Gene Name: IFNG interferon, gamma [ Oryctolagus cuniculus ]
Official Symbol: IFNg
Synonyms: IFNG; interferon, gamma; interferon gamma; IFN gamma; IFN-gamma;
Gene ID: 100008602
mRNA Refseq: NM_001081991
Protein Refseq: NP_001075460

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.