"LY96" Related Products

Expand
Expand
Expand

Recombinant Human LY96, GST-tagged

Cat.No.: LY96-154H
Product Overview: Recombinant Human LY96(19 a.a. - 160 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: This gene encodes a protein which associates with toll-like receptor 4 on the cell surface and confers responsiveness to lipopolysaccyaride (LPS), thus providing a link between the receptor and LPS signaling. Studies of the mouse ortholog suggest that this gene may be involved in endotoxin neutralization. Alternative splicing results in multiple transcript variants encoding different isoforms.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 41.36 kDa
AA Sequence: QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEV ICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: LY96 lymphocyte antigen 96 [ Homo sapiens ]
Official Symbol: LY96
Synonyms: LY96; lymphocyte antigen 96; MD2; MD-2; ly-96; ESOP-1; myeloid differentiation protein-2; MD-2 protein; protein MD-2
Gene ID: 23643
mRNA Refseq: NM_015364
Protein Refseq: NP_056179
MIM: 605243
UniProt ID: Q9Y6Y9
Chromosome Location: 8q21.11
Pathway: Pathogenic Escherichia coli infection; Toll-like receptor signaling pathway; Signaling in Immune system
Function: coreceptor activity; lipopolysaccharide receptor activity; protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.