"HSD17B12" Related Products

Expand
Expand
Expand

Recombinant Human HSD17B12, GST-tagged

Cat.No.: HSD17B12-47H
Product Overview: Recombinant Human HSD17B12(203 a.a. - 271 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: This gene encodes a very important 17beta-hydroxysteroid dehydrogenase (17beta-HSD) that converts estrone into estradiol in ovarian tissue. This enzyme is also involved in fatty acid elongation.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 33.33 kDa
AA Sequence: SATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLAKIRKPTLDKPSPETFVKSAIKTVGLQSRTNG
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: HSD17B12 hydroxysteroid (17-beta) dehydrogenase 12 [Homo sapiens]
Official Symbol: HSD17B12
Synonyms: HSD17B12; hydroxysteroid (17-beta) dehydrogenase 12; 17beta-HSD type 12; KAR; estradiol 17-beta-dehydrogenase 12; SDR12C1; short chain dehydrogenase/reductase family 12C, member 1; 17-beta-HSD 12; steroid dehydrogenase homolog; 17-beta-hydroxysteroid dehydrogenase 12; EC 1.1.1.62; 3-ketoacyl-CoA reductase; EC 1.3.1.-; OTTHUMP00000232808
Gene ID: 51144
mRNA Refseq: NM_016142
Protein Refseq: NP_057226
MIM: 609574
UniProt ID: Q53GQ0
Chromosome Location: 11p11.2
Pathway: Androgen biosynthesis; Fatty acid biosynthesis; Metabolism
Function: collagen binding; estradiol 17-beta-dehydrogenase activity; fibronectin binding; heparin binding; protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.