"SLC5A1" Related Products

Expand
Expand

Recombinant Human SLC5A1, GST-tagged

Cat.No.: SLC5A1-2775H
Product Overview: Recombinant Human SLC5A1(1 a.a. - 664 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: This gene encodes a member of the sodium-dependent glucose transporter (SGLT) family. The encoded integral membrane protein is the primary mediator of dietary glucose and galactose uptake from the intestinal lumen. Mutations in this gene have been associated with glucose-galactose malabsorption. Multiple transcript variants encoding different isoforms have been found for this gene.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 99.99 kDa
AA Sequence: MDSSTWSPKTTAVTRPVETHELIRNAADISIIVIYFVVVMAVGLWAMFSTNRGTVGGFFLAGRSMVWWPIGASLF ASNIGSGHFVGLAGTGAASGIAIGGFEWNALVLVVVLGWLFVPIYIKAGVVTMPEYLRKRFGGQRIQVYLSLLSL LLYIFTKISADIFSGAIFINLALGLNLYLAIFLLLAITALYTITGGLAAVIYTDTLQTVIMLVGSLILTGFAFHE VGGYDAFMEKYMKAIPTIVSDGNTTFQEKCYTPRADSFHIFRDPLTGDLPWPGFIFGMSILTLWYWCTDQVIVQR CLSAKNMSHVKGGCILCGYLKLMPMFIMVMPGMISRILYTEKIACVVPSECEKYCGTKVGCTNIAYPTLVVELMP NGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYAKVRKRASEKELMIAGRLFILVLIGISIAWVPIVQSAQSG QLFDYIQSITSYLGPPIAAVFLLAIFWKRVNEPGAFWGLILGLLIGISRMITEFAYGTGSCMEPSNCPTIICGVH YLYFAIILFAISFITIVVISLLTKPIPDVHLYRLCWSLRNSKEERIDLDAEEENIQEGPKETIEIETQVPEKKKG IFRRAYDLFCGLEQHGAPKMTEEEEKAMKMKMTDTSEKPLWRTVLNVNGIILVTVAVFCHAYFA
Applications: ELISA; WB-Re; AP; Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: SLC5A1 solute carrier family 5 (sodium/glucose cotransporter), member 1 [ Homo sapiens (human) ]
Official Symbol: SLC5A1
Synonyms: SLC5A1; solute carrier family 5 (sodium/glucose cotransporter), member 1; SGLT1; sodium/glucose cotransporter 1; D22S675; NAGT; Na+/glucose cotransporter 1; high affinity sodium-glucose cotransporter
Gene ID: 6523
mRNA Refseq: NM_000343
Protein Refseq: NP_000334
MIM: 182380
UniProt ID: P13866
Chromosome Location: 22q12.3
Pathway: Bile secretion; Carbohydrate digestion and absorption; Hexose transport
Function: glucose:sodium symporter activity; protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.