"WNT10A" Related Products

Expand
Expand

Recombinant Human WNT10A, His-tagged

Cat.No.: WNT10A-36H
Product Overview: A DNA sequence encoding human WNT10A corresponding to amino acid (1-417) was expressed with a C-terminal polyhistidine tag.
Source: Insect cells
Species: Human
Tag: His
Form: PBS pH7.4
AA Sequence: MGSAHPRPWLRLRPQPQPRPALWVLLFFLLLLAAAMPRSAPNDILDLRLPPEPVLNANTVCLTLPGLSRRQMEVC VRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYESPIFSRGFRESAFAYAIAAAGVVHAVSNACA LGKLKACGCDASRRGDEEAFRRKLHRLQLDALQRGKGLSHGVPEHPALPTASPGLQDSWEWGGCSPDMGFGERFS KDFLDSREPHRDIHARMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRTVGALLRSRFHRATLI RPHNRNGGQLEPGPAGAPSPAPGAPGPRRRASPADLVYFEKSPDFCEREPRLDSAGTVGRLCNKSSAGSDGCGSM CCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK
Purity: >90% as determined by SDS-PAGE
Storage: Store it at +4°C for short term. For long term storage, store it at -20°C - -70°C. Avoid freeze-thaw cycles.
Gene Name: WNT10A wingless-type MMTV integration site family, member 10A [ Homo sapiens ]
Official Symbol: WNT10A
Synonyms: WNT10A; wingless-type MMTV integration site family, member 10A;
Gene ID: 93651

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.