"MSH3" Related Products

Recombinant Human MSH3 protein, His-tagged

Cat.No.: MSH3-494H
Product Overview: Recombinant Human MSH3(1-350aa) fused with His tag at N-terminal was expressed in E. coli.
Description: The protein encoded by this gene forms a heterodimer with MSH2 to form MutS beta, part of the post-replicative DNA mismatch repair system. MutS beta initiates mismatch repair by binding to a mismatch and then forming a complex with MutL alpha heterodimer. This gene contains a polymorphic 9 bp tandem repeat sequence in the first exon. The repeat is present 6 times in the reference genome sequence and 3-7 repeats have been reported. Defects in this gene are a cause of susceptibility to endometrial cancer.
Source: E. coli
Species: Human
Tag: His
Form: 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), added with 300 mM Imidazole and 0.7% sarcosyl, 15% glycerol.
Protein length: 1-350aa
AA Sequence: MSRRKPASGGLAASSSAPARQAVLSRFFQSTGSLKSTSSSTGAADQVDPGAAAAAAAAAATAPPAPPAPAFPPQL PPHIATEIDRRKKRPLENDGPVKKKVKKVQQKEGGSDLGMSGNSEPKKCLRTRNVSKSLEKLKEFCCDSALPQSR VQTESLQERFAVLPKCTDFDDISLLHAKNAVSSEDSKRQINQKDTTLFDLSQFGSSNTSHENLQKTASKSANKRS KSIYTPLELQYIEMKQQHKDAVLCVECGYKYRFFGEDAEIAARELNIYCHLDHNFMTASIPTHRLFVHVRRLVAK GYKVGVVKQTETAALKAIGDNRSSLFSRKLTALYTKSTLIGEDVNPLIKL
Storage: Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.Storage of Reconstituted ProteinShort-term storage: Store at 2-8 centigrade for two weeks.Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution: ReconsBtute at 0.25 µg/μl in 200 μl sterile water for short-term storage.ReconsBtuBon with 200 μl 50% glycerol soluBon is recommended for longer term storage (see Stability and Storage for more details).If a different concentraBon is needed for your purposes please adjust the reconsBtuBon volume as required (please note: the ion concentraBon of the final soluBon will vary according to the volume used).Note: Centrifuge vial before opening. When reconsBtuBng, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into soluBon.
Shipping: The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.
Gene Name: MSH3 mutS homolog 3 (E. coli) [ Homo sapiens ]
Official Symbol: MSH3
Synonyms: MSH3; mutS homolog 3 (E. coli); mutS (E. coli) homolog 3; DNA mismatch repair protein Msh3; Divergent upstream protein; DUP; Mismatch repair protein 1; MRP1; hMSH3; mismatch repair protein 1; divergent upstream protein; MGC163306; MGC163308;
Gene ID: 4437
mRNA Refseq: NM_002439
Protein Refseq: NP_002430
MIM: 600887
UniProt ID: P20585
Chromosome Location: 5q11-q12
Pathway: Colorectal cancer, organism-specific biosystem; Colorectal cancer, conserved biosystem; Mismatch repair, organism-specific biosystem; Mismatch repair, conserved biosystem; Pathways in cancer, organism-specific biosystem;
Function: ATP binding; DNA-dependent ATPase activity; Y-form DNA binding; centromeric DNA binding; damaged DNA binding; contributes_to dinucleotide insertion or deletion binding; contributes_to dinucleotide repeat insertion binding; double-strand/single-strand DNA junction binding; enzyme binding; NOT guanine/thymine mispair binding; loop DNA binding; contributes_to mismatched DNA binding; nucleotide binding; NOT contributes_to oxidized purine DNA binding; protein binding; NOT protein homodimerization activity; contributes_to single guanine insertion binding; contributes_to single-stranded DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.