Recombinant E. coli mBanana Protein, His-tagged
| Cat.No. : | mBanana-13 |
| Product Overview : | Purified fluorescent protein mBanana with N-terminal His tag was expressed in E. coli. |
| Availability | July 18, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | E.coli |
| Source : | E.coli |
| Tag : | His |
| Molecular Mass : | 26.4 kDa |
| AA Sequence : | MVSKGEENNMAVIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFCYGSKAYVKHPTGIPDYFKLSFPEGFKWERVMNFEDGGVVTVAQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKMRLKLKDGGHYSAETKTTYKAKKPVQLPGAYIAGEKIDITSHNEDYTIVELYERAEGRHSTGGMDELYK |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration : | >50 ug/mL as determined by microplate BCA method |
| Storage Buffer : | PBS, pH7.4, 10% glycerol. |
| Publications : |
| ◆ Recombinant Proteins | ||
| mBanana-13 | Recombinant E. coli mBanana Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All mBanana Products
Required fields are marked with *
My Review for All mBanana Products
Required fields are marked with *




