Recombinant E. coli mBanana Protein, His-tagged
Cat.No. : | mBanana-13 |
Product Overview : | Purified fluorescent protein mBanana with N-terminal His tag was expressed in E. coli. |
Availability | June 27, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
Molecular Mass : | 26.4 kDa |
AA Sequence : | MVSKGEENNMAVIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFCYGSKAYVKHPTGIPDYFKLSFPEGFKWERVMNFEDGGVVTVAQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKMRLKLKDGGHYSAETKTTYKAKKPVQLPGAYIAGEKIDITSHNEDYTIVELYERAEGRHSTGGMDELYK |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | >50 ug/mL as determined by microplate BCA method |
Storage Buffer : | PBS, pH7.4, 10% glycerol. |
Publications : |
Measurement of 3-photon excitation and emission spectra and verification of Kasha’s rule for selected fluorescent proteins excited at the 1700-nm window (2019)
|
◆ Recombinant Proteins | ||
mBanana-13 | Recombinant E. coli mBanana Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All mBanana Products
Required fields are marked with *
My Review for All mBanana Products
Required fields are marked with *