Recombinant Human MT1X, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human MT1X, GST-tagged

Recombinant Human MT1X, GST-tagged

MT1X Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : MT1X-129H
Product Overview : Recombinant Human MT1X(1 a.a. - 61 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description : Metallothionein 1X, also known as MT1X, is a protein which in humans is encoded by the gene.
Source : Wheat germ
Species : Human
Tag : GST
Molecular Mass : 33.11 kDa
AA Sequence : MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSCCA
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : MT1X metallothionein 1X [ Homo sapiens (human) ]
Official Symbol : MT1X
Synonyms : MT1X; MT1; MT-1l; metallothionein 1X; metallothionein-1X; MT-1X; MT-IX; metallothionein-IX
Gene ID : 4501
mRNA Refseq : NM_005952
Protein Refseq : NP_005943
MIM : 156359
UniProt ID : P80297
Chromosome Location : 16q13
Pathway : Mineral absorption; Oxidative Stress
Function : metal ion binding; zinc ion binding

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.