"MT1X" Related Products

Expand

Recombinant Human MT1X, GST-tagged

Cat.No.: MT1X-129H
Product Overview: Recombinant Human MT1X(1 a.a. - 61 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: Metallothionein 1X, also known as MT1X, is a protein which in humans is encoded by the gene.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 33.11 kDa
AA Sequence: MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSCCA
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: MT1X metallothionein 1X [ Homo sapiens (human) ]
Official Symbol: MT1X
Synonyms: MT1X; MT1; MT-1l; metallothionein 1X; metallothionein-1X; MT-1X; MT-IX; metallothionein-IX
Gene ID: 4501
mRNA Refseq: NM_005952
Protein Refseq: NP_005943
MIM: 156359
UniProt ID: P80297
Chromosome Location: 16q13
Pathway: Mineral absorption; Oxidative Stress
Function: metal ion binding; zinc ion binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.