Recombinant Human MTL5, GST-tagged MTL5-133H

Recombinant Human MTL5, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human MTL5, GST-tagged

Recombinant Human MTL5, GST-tagged

MTL5 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : MTL5-133H
Product Overview : Recombinant Human MTL5(1 a.a. - 306 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description : Metallothionein proteins are highly conserved low-molecular-weight cysteine-rich proteins that are induced by and bind to heavy metal ions and have no enzymatic activity. They may play a central role in the regulation of cell growth and differentiation and are involved in spermatogenesis. This gene encodes a metallothionein-like protein which has been shown to be expressed differentially in mouse testis and ovary. Two transcript variants encoding different isoforms have been found for this gene.
Source : Wheat germ
Species : Human
Tag : GST
Molecular Mass : 58.7 kDa
AA Sequence : MEEGPLPGGLPSPEDAMVTELLSPEGPFASENIGLKAPVKYEEDEFHVFKEAYLGPADPKEPVLHAFNPALGADC KGQVKAKLAGGDSDGGELLGEYPGIPELSALEDVALLQAPQPPACNVHFLSSLLPAHRSPAVLPLGAWVLEGASH PGVRMIPVEIKEAGGTTTSNNPEEATLQNLLAQESCCKFPSSQELEDASCCSLKKDSNPMVICQLKGGTQMLCID NSRTRELKALHLVPQYQDQNNYLQSDVPKPMTALVGRFLPASTKLNLITQQLEGALPSVVNGSAFPSGSTLPGPP KITLAG
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : MTL5 metallothionein-like 5, testis-specific (tesmin) [ Homo sapiens (human) ]
Official Symbol : MTL5
Synonyms : MTL5; MTLT; CXCDC2; TESMIN; metallothionein-like 5, testis-specific (tesmin); tesmin; CXC domain containing 2; testis-specific metallothionein-like protein
Gene ID : 9633
mRNA Refseq : NM_001039656
Protein Refseq : NP_001034745
MIM : 604374
UniProt ID : Q9Y4I5
Chromosome Location : 11q13.2-q13.3
Function : metal ion binding

Products Types

◆ Recombinant Protein

MTL5-3811RRecombinant Rat MTL5 Protein+Inquiry
MTL5-134HRecombinant Human MTL5, GST-tagged+Inquiry

See All MTL5 Recombinant Protein

Related Gene

MTL5

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy