"MTL5" Related Products

Recombinant Human MTL5, GST-tagged

Cat.No.: MTL5-133H
Product Overview: Recombinant Human MTL5(1 a.a. - 306 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: Metallothionein proteins are highly conserved low-molecular-weight cysteine-rich proteins that are induced by and bind to heavy metal ions and have no enzymatic activity. They may play a central role in the regulation of cell growth and differentiation and are involved in spermatogenesis. This gene encodes a metallothionein-like protein which has been shown to be expressed differentially in mouse testis and ovary. Two transcript variants encoding different isoforms have been found for this gene.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 58.7 kDa
AA Sequence: MEEGPLPGGLPSPEDAMVTELLSPEGPFASENIGLKAPVKYEEDEFHVFKEAYLGPADPKEPVLHAFNPALGADC KGQVKAKLAGGDSDGGELLGEYPGIPELSALEDVALLQAPQPPACNVHFLSSLLPAHRSPAVLPLGAWVLEGASH PGVRMIPVEIKEAGGTTTSNNPEEATLQNLLAQESCCKFPSSQELEDASCCSLKKDSNPMVICQLKGGTQMLCID NSRTRELKALHLVPQYQDQNNYLQSDVPKPMTALVGRFLPASTKLNLITQQLEGALPSVVNGSAFPSGSTLPGPP KITLAG
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: MTL5 metallothionein-like 5, testis-specific (tesmin) [ Homo sapiens (human) ]
Official Symbol: MTL5
Synonyms: MTL5; MTLT; CXCDC2; TESMIN; metallothionein-like 5, testis-specific (tesmin); tesmin; CXC domain containing 2; testis-specific metallothionein-like protein
Gene ID: 9633
mRNA Refseq: NM_001039656
Protein Refseq: NP_001034745
MIM: 604374
UniProt ID: Q9Y4I5
Chromosome Location: 11q13.2-q13.3
Function: metal ion binding
Products Types ◆ Recombinant Protein

Related Gene

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.