"MUC5B" Related Products

Expand

Recombinant Human MUC5B, GST-tagged

Cat.No.: MUC5B-1030H
Product Overview: Recombinant Human MUC5B(4186 a.a. - 4295 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: This gene encodes a member of the mucin family of proteins, which are highly glycosylated macromolecular components of mucus secretions. This family member is the major gel-forming mucin in mucus. It is a major contributor to the lubricating and viscoelastic properties of whole saliva, normal lung mucus and cervical mucus. This gene has been found to be up-regulated in some human diseases, including sinus mucosa of chronic rhinosinusitis (CRS), CRS with nasal polyposis, chronic obstructive pulmonary disease (COPD) and H. pylori-associated gastric disease, and it may be involved in the pathogenesis of these diseases.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 37.84 kDa
AA Sequence: CEEDSCQVRINTTILWHQGCETEVNITFCEGSCPGASKYSAEAQAMQHQCTCCQERRVHEETVPLHCPNGSAILH TYTHVDECGCTPFCVPAPMAPPHTRGFPAQEATAV
Applications: ELISA; WB-Re; AP; Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: MUC5B mucin 5B, oligomeric mucus/gel-forming [ Homo sapiens (human) ]
Official Symbol: MUC5B
Synonyms: MUC5B; mucin 5B, oligomeric mucus/gel-forming; MG1; MUC5; MUC9; MUC-5B; mucin-5B; cervical mucin MUC5B; high molecular weight salivary mucin MG1; mucin 5, subtype B, tracheobronchial; sublingual gland mucin
Gene ID: 727897
mRNA Refseq: NM_002458
Protein Refseq: NP_002449
MIM: 600770
UniProt ID: Q9HC84
Chromosome Location: 11p15.5
Pathway: Metabolism of proteins; O-linked glycosylation; Post-translational protein modification; Salivary secretion
Function: protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.