Recombinant Human MUC5B, GST-tagged MUC5B-1030H

Recombinant Human MUC5B, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human MUC5B, GST-tagged

Recombinant Human MUC5B, GST-tagged

MUC5B Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : MUC5B-1030H
Product Overview : Recombinant Human MUC5B(4186 a.a. - 4295 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description : This gene encodes a member of the mucin family of proteins, which are highly glycosylated macromolecular components of mucus secretions. This family member is the major gel-forming mucin in mucus. It is a major contributor to the lubricating and viscoelastic properties of whole saliva, normal lung mucus and cervical mucus. This gene has been found to be up-regulated in some human diseases, including sinus mucosa of chronic rhinosinusitis (CRS), CRS with nasal polyposis, chronic obstructive pulmonary disease (COPD) and H. pylori-associated gastric disease, and it may be involved in the pathogenesis of these diseases.
Source : Wheat germ
Species : Human
Tag : GST
Molecular Mass : 37.84 kDa
AA Sequence : CEEDSCQVRINTTILWHQGCETEVNITFCEGSCPGASKYSAEAQAMQHQCTCCQERRVHEETVPLHCPNGSAILH TYTHVDECGCTPFCVPAPMAPPHTRGFPAQEATAV
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : MUC5B mucin 5B, oligomeric mucus/gel-forming [ Homo sapiens (human) ]
Official Symbol : MUC5B
Synonyms : MUC5B; mucin 5B, oligomeric mucus/gel-forming; MG1; MUC5; MUC9; MUC-5B; mucin-5B; cervical mucin MUC5B; high molecular weight salivary mucin MG1; mucin 5, subtype B, tracheobronchial; sublingual gland mucin
Gene ID : 727897
mRNA Refseq : NM_002458
Protein Refseq : NP_002449
MIM : 600770
UniProt ID : Q9HC84
Chromosome Location : 11p15.5
Pathway : Metabolism of proteins; O-linked glycosylation; Post-translational protein modification; Salivary secretion
Function : protein binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy