Recombinant Human F9 therapeutic protein(Coagulation Factor IX (Recombinant))
Cat.No. : | F9-P026H |
Product Overview : | Human Factor IX protein, produced by recombinant DNA technology for use in therapy of factor IX deficiency, known as hemophilia B or Christmas disease. Coagulation Factor IX (Recombinant) is a glycoprotein with an approximate molecular mass of 55,000 Da consisting of 415 amino acids in a single chain. It has a primary amino acid sequence that is identical to the Ala 148 allelic form of plasma-derived factor IX. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Protein Length : | 415 Aa |
Description : | This gene encodes vitamin K-dependent coagulation factor IX that circulates in the blood as an inactive zymogen. This factor is converted to an active form by factor XIa, which excises the activation peptide and thus generates a heavy chain and a light chain held together by one or more disulfide bonds. The role of this activated factor IX in the blood coagulation cascade is to activate factor X to its active form through interactions with Ca+2 ions, membrane phospholipids, and factor VIII. Alterations of this gene, including point mutations, insertions and deletions, cause factor IX deficiency, which is a recessive X-linked disorder, also called hemophilia B or Christmas disease. The expression product is the active ingredient of Benefix. |
Molecular Mass : | 46.55 kDa |
AA Sequence : | YNSGKLEEFVQGNLERECMEEKCSFEEAREVFENTERTTEFWKQYVDGDQCESNPCLNGGSCKDDINSYEC WCPFGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVSQTSK LTRAEAVFPDVDYVNSTEAETILDNITQSTQSFNDFTRVVGGEDAKPGQFPWQVVLNGKVDAFCGGSIVNE KWIVTAAHCVETGVKITVVAGEHNIEETEHTEQKRNVIRIIPHHNYNAAINKYNHDIALLELDEPLVLNSY VTPICIADKEYTNIFLKFGSGYVSGWGRVFHKGRSALVLQYLRVPLVDRATCLRSTKFTIYNNMFCAGFHE GGRDSCQGDSGGPHVTEVEGTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTKLT |
Endotoxin : | < 1.0 EU per μg of the protein |
Purity : | >95% |
Storage : | Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
Alias : | F9; FIX; F9 p22; FIX F9; P19; PTC; HEMB; THPH8; Coagulation Factor IX (Recombinant) |
Gene Name | F9 coagulation factor IX [ Homo sapiens ] |
Official Symbol | F9 |
Synonyms | F9; coagulation factor IX; Christmas disease; Factor IX; FIX; hemophilia B; plasma thromboplastic component; F9 p22; FIX F9; factor 9; factor IX F9; serine protease; Christmas factor; plasma thromboplastin component; P19; PTC; HEMB; THPH8; MGC129641; MGC129642; |
Gene ID | 2158 |
mRNA Refseq | NM_000133 |
Protein Refseq | NP_000124 |
MIM | 300746 |
UniProt ID | P00740 |
Chromosome Location | Xq26.3-q27.1 |
Pathway | Blood Clotting Cascade, organism-specific biosystem; Complement and Coagulation Cascades, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Extrinsic Pathway, organism-specific biosystem; Formation of Fibrin Clot (Clotting Cascade), organism-specific biosystem; Gamma-carboxylation of protein precursors, organism-specific biosystem; |
Function | calcium ion binding; peptidase activity; serine-type endopeptidase activity; |
◆ Recombinant Proteins | ||
F9-258H | Active Recombinant Human F9 protein, Fc-tagged | +Inquiry |
F9-4418HF | Recombinant Full Length Human F9 Protein, GST-tagged | +Inquiry |
F9-4098H | Recombinant Human F9 Protein (Met1-Thr461), C-His tagged | +Inquiry |
F9-1358R | Recombinant Rhesus Macaque F9 Protein, His (Fc)-Avi-tagged | +Inquiry |
F9-7807H | Recombinant Human F9 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
F9-5405M | Native Mouse Coagulation Factor IX | +Inquiry |
F9-671H | Native Human Coagulation Factor IX | +Inquiry |
F9-26523H | Active Native Human F9 Protein | +Inquiry |
F9-301R | Native Rat Factor IXa | +Inquiry |
F9-266B | Active Native Bovine Factor IX | +Inquiry |
◆ Cell & Tissue Lysates | ||
F9-1768MCL | Recombinant Mouse F9 cell lysate | +Inquiry |
F9-1849HCL | Recombinant Human F9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All F9 Products
Required fields are marked with *
My Review for All F9 Products
Required fields are marked with *