Recombinant Human GLA therapeutic protein GLA-P027H

Recombinant Human GLA therapeutic protein

PRODUCTS

Home / Products / Recombinant Human GLA therapeutic protein

Recombinant Human GLA therapeutic protein

GLA Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : GLA-P027H
Product Overview : Recombinant human alpha-galactosidase A. The mature protein is composed of 2 subunits of 398 residues. Protein is glycosylated and produced by CHO cells.
Description : This gene encodes a homodimeric glycoprotein that hydrolyses the terminal alpha-galactosyl moieties from glycolipids and glycoproteins. This enzyme predominantly hydrolyzes ceramide trihexoside, and it can catalyze the hydrolysis of melibiose into galactose and glucose. A variety of mutations in this gene affect the synthesis, processing, and stability of this enzyme, which causes Fabry disease, a rare lysosomal storage disorder that results from a failure to catabolize alpha-D-galactosyl glycolipid moieties. The expression product is the active ingredient of Fabrazyme and Replagal.
Source : CHO
Species : Human
Molecular Mass : 45.4 kDa
Protein length : 398 Aa
AA Sequence : LDNGLARTPTMGWLHWERFMCNLDCQEEPDSCISEKLFMEMAELMVSEGWKDAGYEYLCIDDCWMAPQRDS EGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTFADWGVDLLKFDGCY CDSLENLADGYKHMSLALNRTGRSIVYSCEWPLYMWPFQKPNYTEIRQYCNHWRNFADIDDSWKSIKSILD WTSFNQERIVDVAGPGGWNDPDMLVIGNFGLSWNQQVTQMALWAIMAAPLFMSNDLRHISPQAKALLQDKD VIAINQDPLGKQGYQLRQGDNFEVWERPLSGLAWAVAMINRQEIGGPRSYTIAVASLGKGVACNPACFITQ LLPVKRKLGFYEWTSRLRSHINPTGTVLLQLENTMQMSLKDLL
Endotoxin : < 1.0 EU per μg of the protein
Purity : >95%
Storage : Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
Gene Name : GLA galactosidase, alpha [ Homo sapiens ]
Official Symbol : GLA
Synonyms : GLA; galactosidase, alpha; alpha-galactosidase A; GALA; melibiase; alpha-gal A; agalsidase alfa; alpha-D-galactosidase A; alpha-D-galactoside galactohydrolase 1;
Gene ID : 2717
mRNA Refseq : NM_000169
Protein Refseq : NP_000160
MIM : 300644
UniProt ID : P06280
Chromosome Location : Xq21.3-q22
Pathway : Galactose metabolism, organism-specific biosystem; Galactose metabolism, conserved biosystem; Glycerolipid metabolism, organism-specific biosystem; Glycerolipid metabolism, conserved biosystem; Glycosphingolipid biosynthesis - globo series, organism-specific biosystem; Glycosphingolipid biosynthesis - globo series, conserved biosystem; Glycosphingolipid metabolism, organism-specific biosystem;
Function : alpha-galactosidase activity; alpha-galactosidase activity; alpha-galactosidase activity; catalytic activity; cation binding; galactoside binding; hydrolase activity; hydrolase activity, hydrolyzing O-glycosyl compounds; protein binding; protein homodimerization activity; raffinose alpha-galactosidase activity; receptor binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy