Recombinant Human IL2/diphtheria toxin, His-tagged therapeutic protein

PRODUCTS

Home / Products / Recombinant Human IL2/diphtheria toxin, His-tagged therapeutic protein

Recombinant Human IL2/diphtheria toxin, His-tagged therapeutic protein

IL2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : diphtheria toxin&IL2-P031H
Product Overview : A recombinant DNA-derived cytotoxic protein composed of the amino acid sequences for diphtheria toxin fragments A and B (Met 1-Thr 387)-His followed by the sequences for interleukin-2 (IL-2; Ala 1-Thr 133). It is produced in an E. coli expression system.
Description : The expression product is the active ingredient of Ontak.
Source : E. coli
Species : Human
Tag : His
Molecular Mass : 57.6 kDa
Protein length : diphtheria toxin fragments A and B (Met 1-Thr 387); IL-2(la 1-Thr 133)
AA Sequence : MGADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDDWKGFYSTDNKYDAAGYSVDNE NPLSGKAGGVVKVTYPGLTKVLALKVDNAETIKKELGLSLTEPLMEQVGTEEFIKRFGDGASRVVLSLPFA EGSSSVEYINNWEQAKALSVELEINFETRGKRGQDAMYEYMAQACAGNRVRRSVGSSLSCINLDWDVIRDK TKTKIESLKEHGPIKNKMSESPNKTVSEEKAKQYLEEFHQTALEHPELSELKTVTGTNPVFAGANYAAWAV NVAQVIDSETADNLEKTTAALSILPGIGSVMGIADGAVHHNTEEIVAQSIALSSLMVAQAIPLVGELVDIG FAAYNFVESIINLFQVVHNSYNRPAYSPGHKTHAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNP KLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMC EYADETATIVEFLNRWITFCQSIISTLT
Endotoxin : < 1.0 EU per μg of the protein
Purity : >95%
Storage : Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
Gene Name : IL2 interleukin 2 [ Homo sapiens ]
Official Symbol : IL2
Synonyms : IL2; interleukin 2; interleukin-2; IL 2; T cell growth factor; TCGF; aldesleukin; involved in regulation of T-cell clonal expansion; IL-2; lymphokine;
Gene ID : 3558
mRNA Refseq : NM_000586
Protein Refseq : NP_000577
MIM : 147680
UniProt ID : P60568
Chromosome Location : 4q26-q27
Pathway : Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Calcium signaling in the CD4+ TCR pathway, organism-specific biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem;
Function : carbohydrate binding; cytokine activity; glycosphingolipid binding; growth factor activity; interleukin-2 receptor binding; interleukin-2 receptor binding; kappa-type opioid receptor binding; kinase activator activity;

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.