"IL2" Related Products

Recombinant Human IL2/diphtheria toxin, His-tagged therapeutic protein

Cat.No.: diphtheria toxin&IL2-P031H
Product Overview: A recombinant DNA-derived cytotoxic protein composed of the amino acid sequences for diphtheria toxin fragments A and B (Met 1-Thr 387)-His followed by the sequences for interleukin-2 (IL-2; Ala 1-Thr 133). It is produced in an E. coli expression system.
Description: The expression product is the active ingredient of Ontak.
Source: E. coli
Species: Human
Tag : His
Molecular Mass: 57.6 kDa
Protein length: diphtheria toxin fragments A and B (Met 1-Thr 387); IL-2(la 1-Thr 133)
AA Sequence: MGADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDDWKGFYSTDNKYDAAGYSVDNE NPLSGKAGGVVKVTYPGLTKVLALKVDNAETIKKELGLSLTEPLMEQVGTEEFIKRFGDGASRVVLSLPFA EGSSSVEYINNWEQAKALSVELEINFETRGKRGQDAMYEYMAQACAGNRVRRSVGSSLSCINLDWDVIRDK TKTKIESLKEHGPIKNKMSESPNKTVSEEKAKQYLEEFHQTALEHPELSELKTVTGTNPVFAGANYAAWAV NVAQVIDSETADNLEKTTAALSILPGIGSVMGIADGAVHHNTEEIVAQSIALSSLMVAQAIPLVGELVDIG FAAYNFVESIINLFQVVHNSYNRPAYSPGHKTHAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNP KLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMC EYADETATIVEFLNRWITFCQSIISTLT
Endotoxin: < 1.0 EU per μg of the protein
Purity: >95%
Storage: Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
Gene Name: IL2 interleukin 2 [ Homo sapiens ]
Official Symbol: IL2
Synonyms: IL2; interleukin 2; interleukin-2; IL 2; T cell growth factor; TCGF; aldesleukin; involved in regulation of T-cell clonal expansion; IL-2; lymphokine;
Gene ID: 3558
mRNA Refseq: NM_000586
Protein Refseq: NP_000577
MIM: 147680
UniProt ID: P60568
Chromosome Location: 4q26-q27
Pathway: Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Calcium signaling in the CD4+ TCR pathway, organism-specific biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem;
Function: carbohydrate binding; cytokine activity; glycosphingolipid binding; growth factor activity; interleukin-2 receptor binding; interleukin-2 receptor binding; kappa-type opioid receptor binding; kinase activator activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.