Recombinant Human IFNB1 therapeutic protein IFNB1-P018H

Recombinant Human IFNB1 therapeutic protein

PRODUCTS

Home / Products / Recombinant Human IFNB1 therapeutic protein

Recombinant Human IFNB1 therapeutic protein

IFNB1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : IFNB1-P018H
Product Overview : Human interferon beta (166 residues), glycosylated, MW=22.5kD. It is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
Description : It has been suggested that IFNB1 be merged into this article or section. The expression product is the active ingredient of Avonex, Belerofon and Rebif.
Source : CHO
Species : Human
Molecular Mass : 20.5KDa
Protein length : 166 Aa
AA Sequence : MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFR QDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCA WTIVRVEILRNFYFINRLTGYLRN
Endotoxin : < 1.0 EU per μg of the protein
Purity : >95%
Storage : Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
Gene Name : IFNB1 interferon, beta 1, fibroblast [ Homo sapiens ]
Official Symbol : IFNB1
Synonyms : IFNB1; interferon, beta 1, fibroblast; IFNB; interferon beta; IFB; IFF; IFN-beta; fibroblast interferon; MGC96956;
Gene ID : 3456
mRNA Refseq : NM_002176
Protein Refseq : NP_002167
MIM : 147640
UniProt ID : P01574
Chromosome Location : 9p22
Pathway : Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem; Cytosolic DNA-sensing pathway, organism-specific biosystem;
Function : cytokine activity; interferon-alpha/beta receptor binding; transcription corepressor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy