"AKAP4" Related Products

Recombinant Human AKAP4, GST-tagged

Cat.No.: AKAP4-16H
Product Overview: Recombinant Human AKAP4 (1 a.a. - 100 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is localized to the sperm flagellum and may be involved in the regulation of sperm motility. Alternative splicing of this gene results in two transcript variants encoding different isoforms.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 36.74 kDa
AA Sequence: MMAYSDTTMMSDDIDWLRSHRGVCKVDLYNPEGQQDQDRKVICFVDVSTLNVEDKDYKDAASSSSEGNLNLGSLE EKEIIVIKDTEKKDQSKTEGSVCLF
Applications: ELISA; WB-Re; AP; Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: AKAP4 A kinase (PRKA) anchor protein 4 [ Homo sapiens (human) ]
Official Symbol: AKAP4
Synonyms: AKAP4; A kinase (PRKA) anchor protein 4; HI; p82; CT99; FSC1; PRKA4; AKAP-4; AKAP82; AKAP 82; hAKAP82; A-kinase anchor protein 4; A-kinase anchor protein 82 kDa; AKAP4; cancer/testis antigen 99; major sperm fibrous sheath protein; protein kinase A anchoring protein 4; protein kinase A-anchoring protein 4; testis-specific gene HI
Gene ID: 8852
mRNA Refseq: NM_003886
Protein Refseq: NP_003877
MIM: 300185
UniProt ID: Q5JQC9
Chromosome Location: Xp11.2
Pathway: G Protein Signaling Pathways
Function: protein kinase A binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.