Recombinant Human AKAP4 protein, His-tagged
Cat.No. : | AKAP4-7463H |
Product Overview : | Recombinant Human AKAP4 protein(565-693 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 565-693 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | TCEEDCPGSTMGYMAQSTQYEKCGGGQSAKALSVKQLESHRAPGPSTCQKENQHLDSQKMDMSNIVLMLIQKLLNENPFKCEDPCEGENKCSEPRASKAASMSNRSDKAEEQCQEHQELDCTSGMKQAN |
Gene Name | AKAP4 A kinase (PRKA) anchor protein 4 [ Homo sapiens ] |
Official Symbol | AKAP4 |
Synonyms | AKAP4; A kinase (PRKA) anchor protein 4; A-kinase anchor protein 4; A kinase anchor protein 82 kDa; AKAP82; cancer/testis antigen 99; CT99; Fsc1; hAKAP82; HI; p82; protein kinase A anchoring protein 4; testis specific gene HI; testis-specific gene HI; A-kinase anchor protein 82 kDa; major sperm fibrous sheath protein; protein kinase A-anchoring protein 4; FSC1; PRKA4; AKAP-4; AKAP 82; |
Gene ID | 8852 |
mRNA Refseq | NM_003886 |
Protein Refseq | NP_003877 |
MIM | 300185 |
UniProt ID | Q5JQC9 |
◆ Recombinant Proteins | ||
AKAP4-2072H | Recombinant Human AKAP4 Protein (189-854 aa), His-tagged | +Inquiry |
AKAP4-109H | Recombinant Human AKAP4 Protein, His-tagged | +Inquiry |
AKAP4-1478M | Recombinant Mouse AKAP4 Protein | +Inquiry |
AKAP4-16H | Recombinant Human AKAP4, GST-tagged | +Inquiry |
AKAP4-247R | Recombinant Rat AKAP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AKAP4 Products
Required fields are marked with *
My Review for All AKAP4 Products
Required fields are marked with *