Recombinant Human AKAP4 protein, His-tagged

• Cat.No.: AKAP4-7463H
• Product Overview: Recombinant Human AKAP4 protein(565-693 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 565-693 aa
• Tag: N-His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: TCEEDCPGSTMGYMAQSTQYEKCGGGQSAKALSVKQLESHRAPGPSTCQKENQHLDSQKMDMSNIVLMLIQKLLNENPFKCEDPCEGENKCSEPRASKAASMSNRSDKAEEQCQEHQELDCTSGMKQAN

Gene Information

• Gene Name: AKAP4 A kinase (PRKA) anchor protein 4 [ Homo sapiens ]
• Official Symbol: AKAP4
• Synonyms: AKAP4; A kinase (PRKA) anchor protein 4; A-kinase anchor protein 4; A kinase anchor protein 82 kDa; AKAP82; cancer/testis antigen 99; CT99; Fsc1; hAKAP82; HI; p82; protein kinase A anchoring protein 4; testis specific gene HI; testis-specific gene HI; A-kinase anchor protein 82 kDa; major sperm fibrous sheath protein; protein kinase A-anchoring protein 4; FSC1; PRKA4; AKAP-4; AKAP 82
• Gene ID: 8852
• mRNA Refseq: NM_003886
• Protein Refseq: NP_003877
• MIM: 300185
• UniProt ID: Q5JQC9