Recombinant Human AKAP4, GST-tagged

Cat.No. : AKAP4-16H
Product Overview : Recombinant Human AKAP4 (1 a.a. - 100 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is localized to the sperm flagellum and may be involved in the regulation of sperm motility. Alternative splicing of this gene results in two transcript variants encoding different isoforms.
Molecular Mass : 36.74 kDa
AA Sequence : MMAYSDTTMMSDDIDWLRSHRGVCKVDLYNPEGQQDQDRKVICFVDVSTLNVEDKDYKDAASSSSEGNLNLGSLE EKEIIVIKDTEKKDQSKTEGSVCLF
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AKAP4 A kinase (PRKA) anchor protein 4 [ Homo sapiens (human) ]
Official Symbol AKAP4
Synonyms AKAP4; A kinase (PRKA) anchor protein 4; HI; p82; CT99; FSC1; PRKA4; AKAP-4; AKAP82; AKAP 82; hAKAP82; A-kinase anchor protein 4; A-kinase anchor protein 82 kDa; AKAP4; cancer/testis antigen 99; major sperm fibrous sheath protein; protein kinase A anchoring protein 4; protein kinase A-anchoring protein 4; testis-specific gene HI
Gene ID 8852
mRNA Refseq NM_003886
Protein Refseq NP_003877
MIM 300185
UniProt ID Q5JQC9
Chromosome Location Xp11.2
Pathway G Protein Signaling Pathways
Function protein kinase A binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AKAP4 Products

Required fields are marked with *

My Review for All AKAP4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon