Recombinant Human AKAP4, GST-tagged
Cat.No. : | AKAP4-16H |
Product Overview : | Recombinant Human AKAP4 (1 a.a. - 100 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is localized to the sperm flagellum and may be involved in the regulation of sperm motility. Alternative splicing of this gene results in two transcript variants encoding different isoforms. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | MMAYSDTTMMSDDIDWLRSHRGVCKVDLYNPEGQQDQDRKVICFVDVSTLNVEDKDYKDAASSSSEGNLNLGSLE EKEIIVIKDTEKKDQSKTEGSVCLF |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AKAP4 A kinase (PRKA) anchor protein 4 [ Homo sapiens (human) ] |
Official Symbol | AKAP4 |
Synonyms | AKAP4; A kinase (PRKA) anchor protein 4; HI; p82; CT99; FSC1; PRKA4; AKAP-4; AKAP82; AKAP 82; hAKAP82; A-kinase anchor protein 4; A-kinase anchor protein 82 kDa; AKAP4; cancer/testis antigen 99; major sperm fibrous sheath protein; protein kinase A anchoring protein 4; protein kinase A-anchoring protein 4; testis-specific gene HI |
Gene ID | 8852 |
mRNA Refseq | NM_003886 |
Protein Refseq | NP_003877 |
MIM | 300185 |
UniProt ID | Q5JQC9 |
Chromosome Location | Xp11.2 |
Pathway | G Protein Signaling Pathways |
Function | protein kinase A binding |
◆ Recombinant Proteins | ||
Akap4-3028R | Recombinant Rat Akap4, His-tagged | +Inquiry |
AKAP4-7463H | Recombinant Human AKAP4 protein, His-tagged | +Inquiry |
AKAP4-430M | Recombinant Mouse AKAP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
AKAP4-16H | Recombinant Human AKAP4, GST-tagged | +Inquiry |
AKAP4-1478M | Recombinant Mouse AKAP4 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AKAP4 Products
Required fields are marked with *
My Review for All AKAP4 Products
Required fields are marked with *