Recombinant Human CYP24A1, GST-tagged CYP24A1-251H

Recombinant Human CYP24A1, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CYP24A1, GST-tagged

Recombinant Human CYP24A1, GST-tagged

CYP24A1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CYP24A1-251H
Product Overview : Recombinant Human CYP24A1(415 a.a. - 514 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description : This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein initiates the degradation of 1,25-dihydroxyvitamin D3, the physiologically active form of vitamin D3, by hydroxylation of the side chain. In regulating the level of vitamin D3, this enzyme plays a role in calcium homeostasis and the vitamin D endocrine system. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Source : Wheat germ
Species : Human
Tag : GST
Molecular Mass : 36.74 kDa
AA Sequence : LMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATD NEPVEMLHSGTLVPSRELPIAFCQR
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80oC. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : CYP24A1 cytochrome P450, family 24, subfamily A, polypeptide 1 [ Homo sapiens (human) ]
Official Symbol : CYP24A1
Synonyms : CYP24A1; cytochrome P450, family 24, subfamily A, polypeptide 1; CYP24, cytochrome P450, subfamily XXIV (vitamin D 24 hydroxylase); 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; CP24; P450 CC24; 24-OHase; cytochrome P450 24A1; cytochrome P450-CC24; vitamin D 24-hydroxylase; exo-mitochondrial protein; vitamin D(3) 24-hydroxylase; 1,25-@dihydroxyvitamin D3 24-hydroxylase; cytochrome P450, subfamily XXIV (vitamin D 24-hydroxylase); HCAI; CYP24; P450-CC24; MGC126273; MGC126274
Gene ID : 1591
mRNA Refseq : NM_000782
Protein Refseq : NP_000773
MIM : 126065
UniProt ID : Q07973
Chromosome Location : 20q13
Pathway : Biological oxidations; Cytochrome P450 - arranged by substrate type; Defective CYP11B1 causes Adrenal hyperplasia 4 (AH4)
Function : 1-alpha,25-dihydroxyvitamin D3 24-hydroxylase activity; 25-hydroxycholecalciferol-24-hydroxylase activity; heme binding

Products Types

◆ Recombinant Protein

CYP24A1-1719RRecombinant Rat CYP24A1 Protein+Inquiry
Cyp24a1-8075MRecombinant Mouse Cyp24a1 protein, His & T7-tagged+Inquiry
CYP24A1-6538CRecombinant Chicken CYP24A1+Inquiry
CYP24A1-11768HRecombinant Human CYP24A1, His-tagged+Inquiry
CYP24A1-5569ZRecombinant Zebrafish CYP24A1+Inquiry

See All CYP24A1 Recombinant Protein

◆ Lysates

CYP24A1-7122HCLRecombinant Human CYP24A1 293 Cell Lysate+Inquiry

See All CYP24A1 Lysates

Related Gene

CYP2C19CYP2C9CYP2D6CYP2E1CYP3A4CYP1B1CYP24A1CYP2J2CYP46A1CYP7B1CYP1A2CYP19A1CYP26A1CYP26B1CYP2A6CYP3A5CYP3A7CYP4F11CYP4F3CYP7A1CYP2C6CYP3A23/3A1CYP1A1CYP2B6CYP4A11Cyp11a1CYP2C8CYP2D4CYP3A2CYP2C18CYP3A43CYP4B1CYP2U1CYP2W1CYP39A1CYP2D1CYP2R1CYP26C1CYP27A1CYP2S1CYP2C11CYP4V2CYP4X1CYP4Z1CYP11B1CYP19A1BCYP4F12CYP4F2CYP4F22CYP38CYP27B1CYP27C1CYP2A13CYP2A7CYP20A1CYP21A2CYP4F8CYP17A1CYP2C23CYP4A22CYP4F13Cyp2a1Cyp2a12Cyp2b3Cyp2b9Cyp2c12Cyp2c13Cyp2c22Cyp2c29Cyp2c38Cyp2c39Cyp2c40Cyp2c44Cyp2c50Cyp2c54Cyp2d11Cyp2d12Cyp2d2Cyp2d22Cyp2d26Cyp2d3Cyp2d34Cyp2d40Cyp2d5Cyp2d9Cyp2f2Cyp2f4Cyp2g1Cyp2c37Cyp21a1Cyp3a11Cyp3a13Cyp3a16Cyp3a18Cyp3a25Cyp3a41aCyp3a41bCyp3a57Cyp4a31Cyp4a32Cyp4a8Cyp4f1Cyp4f14Cyp4f15Cyp4f17Cyp4f18Cyp4f6Cyp4v3Cyp51CYP8B1Cyp11b2Cyp11b3Cyp2a2Cyp2a22Cyp2a3Cyp2a4Cyp2a5Cyp2ab1Cyp2b1Cyp2b10Cyp2b12Cyp2b13Cyp2b15Cyp2b19Cyp2b21Cyp2b23Cyp2c6v1Cyp2c65Cyp2c66Cyp2c67Cyp2c68Cyp2c69Cyp2c7CYP2F1Cyp2j10Cyp2j12Cyp2j13Cyp2j4Cyp2j8Cyp2j9Cyp2t1Cyp2t4Cyp3a23Cyp3a44Cyp3a62Cyp3a9Cyp4a1Cyp4a12aCyp4a12bCyp4a14Cyp4a2Cyp4a29Cyp4a3Cyp4a30bCyp4f39Cyp4f4Cyp4f40Cyp4f5CYP51A1Cyp3a59CYP1B1-AS1CYP2B7P1

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy