Recombinant Mouse Cyp24a1 protein

• Cat.No.: Cyp24a1-4608M
• Product Overview: Recombinant Mouse Cyp24a1 protein(Q64441)(36-514 aa) was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 36-514 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 55.6 kDa
• AASequence: RAPKEVPLCPLMTDGETRNVTSLPGPTNWPLLGSLLEIFWKGGLKKQHDTLAEYHKKYGQIFRMKLGSFDSVHLGSPSLLEALYRTESAHPQRLEIKPWKAYRDHRNEAYGLMILEGQEWQRVRSAFQKKLMKPVEIMKLDKKINEVLADFMGQIDELRDERGRIQDLYSELNKWSFESICLVLYEKRFGLLQKDTEEEALTFIAAIKTMMSTFGKMMVTPVELHKRLNTKVWQAHTLAWDTIFKSVKPCIDHRLERYSQQPGADFLCDIYQQDHLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQRLLREIQSVLPDNQTPRAEDVRNMPYLKACLKESMRLTPSVPFTTRTLDKPTVLGEYTLPKGTVLTLNTQVLGSSEDNFEDADKFRPERWLEKEKKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIIQKYNIVATDSEPVEMLHLGILVPSRELPIAFCPR
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: Cyp24a1 cytochrome P450, family 24, subfamily a, polypeptide 1 [ Mus musculus ]
• Official Symbol: Cyp24a1
• Synonyms: CYP24A1; cytochrome P450, family 24, subfamily a, polypeptide 1; 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; cytochrome P450, 24; cytochrome P450 24A1; cytochrome P450-CC24; cytochrome P450, 24a1; vitamin D(3) 24-hydroxylase; 25-hydroxyvitamin D-24-hydroxylase; CP24; Cyp24; 24-OHase; MGC129158; MGC129159
• Gene ID: 13081
• mRNA Refseq: NM_009996
• Protein Refseq: NP_034126