Recombinant Mouse Cyp24a1 protein

Cat.No. : Cyp24a1-4608M
Product Overview : Recombinant Mouse Cyp24a1 protein(Q64441)(36-514 aa) was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 36-514 aa
Form : For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
Molecular Mass : 55.6 kDa
AASequence : RAPKEVPLCPLMTDGETRNVTSLPGPTNWPLLGSLLEIFWKGGLKKQHDTLAEYHKKYGQIFRMKLGSFDSVHLGSPSLLEALYRTESAHPQRLEIKPWKAYRDHRNEAYGLMILEGQEWQRVRSAFQKKLMKPVEIMKLDKKINEVLADFMGQIDELRDERGRIQDLYSELNKWSFESICLVLYEKRFGLLQKDTEEEALTFIAAIKTMMSTFGKMMVTPVELHKRLNTKVWQAHTLAWDTIFKSVKPCIDHRLERYSQQPGADFLCDIYQQDHLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQRLLREIQSVLPDNQTPRAEDVRNMPYLKACLKESMRLTPSVPFTTRTLDKPTVLGEYTLPKGTVLTLNTQVLGSSEDNFEDADKFRPERWLEKEKKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIIQKYNIVATDSEPVEMLHLGILVPSRELPIAFCPR
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.
Gene Name Cyp24a1 cytochrome P450, family 24, subfamily a, polypeptide 1 [ Mus musculus ]
Official Symbol Cyp24a1
Synonyms CYP24A1; cytochrome P450, family 24, subfamily a, polypeptide 1; 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; cytochrome P450, 24; cytochrome P450 24A1; cytochrome P450-CC24; cytochrome P450, 24a1; vitamin D(3) 24-hydroxylase; 25-hydroxyvitamin D-24-hydroxylase; CP24; Cyp24; 24-OHase; MGC129158; MGC129159;
Gene ID 13081
mRNA Refseq NM_009996
Protein Refseq NP_034126

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cyp24a1 Products

Required fields are marked with *

My Review for All Cyp24a1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon