Recombinant Human LDHB, GST-tagged

Cat.No. : LDHB-257H
Product Overview : Recombinant Human LDHB(1 a.a. - 334 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes an enzyme which catalyzes the reversible conversion of lactate and pyruvate, and NAD and NADH, in the glycolytic pathway. Mutations in this gene are associated with lactate dehydrogenase B deficiency. Pseudogenes have been identified on the X chromosome and on chromosome. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Molecular Mass : 62.48 kDa
AA Sequence : MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQT PKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWK LSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDS ENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARG LTSDINQKLKDDEVAQLKKSADTLWDIQKDLKDL
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LDHB lactate dehydrogenase B [ Homo sapiens (human) ]
Official Symbol LDHB
Synonyms LDHB; lactate dehydrogenase B; LDH-H; TRG-5; L-lactate dehydrogenase B chain; LDH-B; LDH heart subunit; OTTHUMP00000165231; renal carcinoma antigen NY-REN-46; EC 1.1.1.27
Gene ID 3945
mRNA Refseq NM_001174097
Protein Refseq NP_001167568
MIM 150100
UniProt ID P07195
Chromosome Location 12p12.2-p12.1
Pathway Abnormal metabolism in phenylketonuria; Cysteine and methionine metabolism; Glycolysis / Gluconeogenesis; Propanoate metabolism
Function L-lactate dehydrogenase activity; NAD binding; identical protein binding; kinase binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LDHB Products

Required fields are marked with *

My Review for All LDHB Products

Required fields are marked with *

0
cart-icon