Recombinant Human LDHA, GST-tagged LDHA-261H

Recombinant Human LDHA, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human LDHA, GST-tagged

Recombinant Human LDHA, GST-tagged

LDHA Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : LDHA-261H
Product Overview : Recombinant Human LDHA(1 a.a. - 332 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description : The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Multiple transcript variants encoding different isoforms have been found for this gene. The human genome contains several non-transcribed pseudogenes of this gene.
Source : Wheat germ
Species : Human
Tag : GST
Molecular Mass : 63.1 kDa
AA Sequence : MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTP KIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKI SGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKE QWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGI SDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : LDHA lactate dehydrogenase A [ Homo sapiens (human) ]
Official Symbol : LDHA
Synonyms : LDHA; lactate dehydrogenase A; LDH1; LDHM; GSD11; PIG19; L-lactate dehydrogenase A chain; LDH-A; LDH-M; LDH muscle subunit; lactate dehydrogenase M; proliferation-inducing gene 19; renal carcinoma antigen NY-REN-59; cell proliferation-inducing gene 19 protein; EC 1.1.1.27
Gene ID : 3939
mRNA Refseq : NM_005566
Protein Refseq : NP_005557
MIM : 150000
UniProt ID : P00338
Chromosome Location : 11p15.4
Pathway : Central carbon metabolism in cancer; Cysteine and methionine metabolism; Glycolysis / Gluconeogenesis
Function : L-lactate dehydrogenase activity; protein binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy