"VDAC1" Related Products

Expand
Expand
Expand

Recombinant human full length VDAC1, GST-tagged

Cat.No.: VDAC1-21H
Product Overview: Recombinant human full length VDAC1(1 a.a. - 283 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: This gene encodes a voltage-dependent anion channel protein that is a major component of the outer mitochondrial membrane. The encoded protein facilitates the exchange of metabolites and ions across the outer mitochondrial membrane and may regulate mitochondrial functions. This protein also forms channels in the plasma membrane and may be involved in transmembrane electron transport. Alternate splicing results in multiple transcript variants. Multiple pseudogenes of this gene are found on chromosomes 1, 2 3, 6, 9, 12, X and Y.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 57.20 kDa
AA Sequence: MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLETKYRWTEYGLTFTEKW NTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKREHINLGCDMDFDIAGPSIRGALVLGYEGWL AGYQMNFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKY QIDPDACFSAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
Applications: ELISA; WB-Re; AP; Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: VDAC1 voltage-dependent anion channel 1 [ Homo sapiens (human) ]
Official Symbol: VDAC1
Synonyms: VDAC1; voltage-dependent anion channel 1; PORIN; VDAC-1; voltage-dependent anion-selective channel protein 1; porin 31HL; porin 31HM; plasmalemmal porin; outer mitochondrial membrane protein porin 1
Gene ID: 7416
mRNA Refseq: NM_003374
Protein Refseq: NP_003365
MIM: 604492
UniProt ID: P21796
Chromosome Location: 5q31
Pathway: Calcium signaling pathway; HTLV-I infection; Huntington's disease; Metabolism of proteins
Function: porin activity; protein kinase binding; voltage-gated anion channel activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.