Recombinant human full length VDAC1, GST-tagged

Cat.No. : VDAC1-21H
Product Overview : Recombinant human full length VDAC1(1 a.a. - 283 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Availability April 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a voltage-dependent anion channel protein that is a major component of the outer mitochondrial membrane. The encoded protein facilitates the exchange of metabolites and ions across the outer mitochondrial membrane and may regulate mitochondrial functions. This protein also forms channels in the plasma membrane and may be involved in transmembrane electron transport. Alternate splicing results in multiple transcript variants. Multiple pseudogenes of this gene are found on chromosomes 1, 2 3, 6, 9, 12, X and Y.
Molecular Mass : 57.20 kDa
AA Sequence : MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLETKYRWTEYGLTFTEKW NTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKREHINLGCDMDFDIAGPSIRGALVLGYEGWL AGYQMNFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKY QIDPDACFSAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Full Length : Full L.
Gene Name VDAC1 voltage-dependent anion channel 1 [ Homo sapiens (human) ]
Official Symbol VDAC1
Synonyms VDAC1; voltage-dependent anion channel 1; PORIN; VDAC-1; voltage-dependent anion-selective channel protein 1; porin 31HL; porin 31HM; plasmalemmal porin; outer mitochondrial membrane protein porin 1
Gene ID 7416
mRNA Refseq NM_003374
Protein Refseq NP_003365
MIM 604492
UniProt ID P21796
Chromosome Location 5q31
Pathway Calcium signaling pathway; HTLV-I infection; Huntington's disease; Metabolism of proteins
Function porin activity; protein kinase binding; voltage-gated anion channel activity

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All VDAC1 Products

Required fields are marked with *

My Review for All VDAC1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon