"PYCARD" Related Products

Recombinant Human PYCARD, GST-tagged

Cat.No.: PYCARD-29108H
Product Overview: Human PYCARD full-length ORF ( AAH13569.2, 1 a.a. - 149 a.a.) recombinant protein with GST-tag at N-terminal.
Description: This gene encodes an adaptor protein that is composed of two protein-protein interaction domains: a N-terminal PYRIN-PAAD-DAPIN domain (PYD) and a C-terminal caspase-recruitment domain (CARD). The PYD and CARD domains are members of the six-helix bundle death domain-fold superfamily that mediates assembly of large signaling complexes in the inflammatory and apoptotic signaling pathways via the activation of caspase. In normal cells, this protein is localized to the cytoplasm; however, in cells undergoing apoptosis, it forms ball-like aggregates near the nuclear periphery. Two transcript variants encoding different isoforms have been found for this gene.
Source: Wheat Germ
Species: Human
Tag: GST
Molecular Mass: 42.13 kDa
AA Sequence: MDALDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAA LIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFNFTPAWNWTCKDLLLQALRESQSYLVEDLERS
Applications: Enzyme-linked Immunoabsorbent Assay, Western Blot, Antibody Production, Protein Array.
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: PYCARD PYD and CARD domain containing [ Homo sapiens (human) ]
Official Symbol: PYCARD
Synonyms: ASC; TMS; TMS1; CARD5; TMS-1
Gene ID: 29108
Protein Refseq: AAH13569.2
MIM: 606838
Chromosome Location: 16p11.2
Pathway: Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem; Influenza A, organism-specific biosystem
Function: Pyrin domain binding; ion channel binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.