Recombinant Human ALK (aa1060-1620), His-tagged ALK-01H

Recombinant Human ALK (aa1060-1620), His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human ALK (aa1060-1620), His-tagged

Recombinant Human ALK (aa1060-1620), His-tagged

ALK Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ALK-01H
Product Overview : Recombinant Human ALK (aa1060-1620), fused with His tag, was expressed in E.coli.
Source : E.coli
Species : Human
Tag : His
Form : 50mM Tris-HCl, 200 mM NaCl, pH 7.4.
Molecular Mass : Theoretical Mw (average): 62.2kDa
AA Sequence : RRKHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQ VSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLR ETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYYR KGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVY RIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGPLVEEEEKVPVRPKDPEGVPPLLVSQQAKREE ERSPAAPPPLPTTSSGKAAKKPTAAEISVRVPRGPAVEGGHVNMAFSQSNPPSELHKVHGSRNKPTSLWNPTYGS WFTEKPTKKNNPIAKKEPHDRGNLGLEGSCTVPPNVATGRLPGASLLLEPSSLTANMKEVPLFRLRHFPCGNVNY GYQQQGLPLEAATAPGAGHYEDTILKSKNSMNQPGP
Purity : >90% as determined by SDS-PAGE
Storage : Store it at +4℃ for short term. For long term storage, store it at -20℃ to -80℃.
Gene Name : ALK anaplastic lymphoma receptor tyrosine kinase [ Homo sapiens ]
Official Symbol : ALK
Synonyms : ALK; anaplastic lymphoma receptor tyrosine kinase; anaplastic lymphoma kinase (Ki 1); ALK tyrosine kinase receptor; CD246; CD246 antigen; mutant anaplastic lymphoma kinase; NBLST3;
Gene ID : 238
mRNA Refseq : NM_004304
Protein Refseq : NP_004295
MIM : 105590
UniProt ID : Q9UM73
Chromosome Location : 2p23
Function : ATP binding; NF-kappaB-inducing kinase activity; nucleotide binding; receptor activity; transmembrane receptor protein tyrosine kinase activity; transmembrane receptor protein tyrosine kinase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy