"ALK" Related Products

Expand
Expand

Recombinant Human ALK (aa1060-1620), His-tagged

Cat.No.: ALK-01H
Product Overview: Recombinant Human ALK (aa1060-1620), fused with His tag, was expressed in E.coli.
Source: E.coli
Species: Human
Tag: His
Form: 50mM Tris-HCl, 200 mM NaCl, pH 7.4.
Molecular Mass: Theoretical Mw (average): 62.2kDa
AA Sequence: RRKHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQ VSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLR ETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYYR KGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVY RIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGPLVEEEEKVPVRPKDPEGVPPLLVSQQAKREE ERSPAAPPPLPTTSSGKAAKKPTAAEISVRVPRGPAVEGGHVNMAFSQSNPPSELHKVHGSRNKPTSLWNPTYGS WFTEKPTKKNNPIAKKEPHDRGNLGLEGSCTVPPNVATGRLPGASLLLEPSSLTANMKEVPLFRLRHFPCGNVNY GYQQQGLPLEAATAPGAGHYEDTILKSKNSMNQPGP
Purity: >90% as determined by SDS-PAGE
Storage: Store it at +4℃ for short term. For long term storage, store it at -20℃ to -80℃.
Gene Name: ALK anaplastic lymphoma receptor tyrosine kinase [ Homo sapiens ]
Official Symbol: ALK
Synonyms: ALK; anaplastic lymphoma receptor tyrosine kinase; anaplastic lymphoma kinase (Ki 1); ALK tyrosine kinase receptor; CD246; CD246 antigen; mutant anaplastic lymphoma kinase; NBLST3;
Gene ID: 238
mRNA Refseq: NM_004304
Protein Refseq: NP_004295
MIM: 105590
UniProt ID: Q9UM73
Chromosome Location: 2p23
Function: ATP binding; NF-kappaB-inducing kinase activity; nucleotide binding; receptor activity; transmembrane receptor protein tyrosine kinase activity; transmembrane receptor protein tyrosine kinase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.