Recombinant Human ALK protein, His-tagged
Cat.No. : | ALK-3120H |
Product Overview : | Recombinant Human ALK protein(1400-1620 aa), fused to His tag, was expressed in E. coli. |
Availability | September 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1400-1620 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | EYGPLVEEEEKVPVRPKDPEGVPPLLVSQQAKREEERSPAAPPPLPTTSSGKAAKKPTAAEISVRVPRGPAVEGGHVNMAFSQSNPPSELHKVHGSRNKPTSLWNPTYGSWFTEKPTKKNNPIAKKEPHDRGNLGLEGSCTVPPNVATGRLPGASLLLEPSSLTANMKEVPLFRLRHFPCGNVNYGYQQQGLPLEAATAPGAGHYEDTILKSKNSMNQPGP |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ALK anaplastic lymphoma receptor tyrosine kinase [ Homo sapiens ] |
Official Symbol | ALK |
Synonyms | ALK; anaplastic lymphoma receptor tyrosine kinase; anaplastic lymphoma kinase (Ki 1); ALK tyrosine kinase receptor; CD246; CD246 antigen; mutant anaplastic lymphoma kinase; NBLST3; |
Gene ID | 238 |
mRNA Refseq | NM_004304 |
Protein Refseq | NP_004295 |
MIM | 105590 |
UniProt ID | Q9UM73 |
◆ Recombinant Proteins | ||
Alk-3270M | Recombinant Mouse Alk, His-tagged | +Inquiry |
ALK-1625R | Recombinant Rhesus Monkey ALK Protein | +Inquiry |
ALK-27H | Recombinant Human ALK (T1151_L1152insT), GST-tagged | +Inquiry |
ALK-49H | Recombinant Human ALK (T1151M), GST-tagged | +Inquiry |
ALK-01H | Active Recombinant Human ALK Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALK Products
Required fields are marked with *
My Review for All ALK Products
Required fields are marked with *